(data stored in ACNUC1104 zone)

EMBL: CP002026.PE123

CP002026.PE123       Location/Qualifiers
FT   CDS             complement(119172..120704)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snov_0123"
FT                   /product="ABC transporter related protein"
FT                   /note="KEGG: bbt:BBta_2128 putative ABC transporter
FT                   ATP-binding protein; PFAM: ABC transporter related; SMART:
FT                   AAA ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Snov_0123"
FT                   /db_xref="EnsemblGenomes-Tr:ADH87460"
FT                   /db_xref="GOA:D7A0V0"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D7A0V0"
FT                   /inference="protein motif:PFAM:PF00005"
FT                   /protein_id="ADH87460.1"
FT                   /translation="MHPTDGSLLELTGFSKSFTGLMALDKVDFTLRRGEIHALLGENGA
FT                   GKSTLIKTMTGVVTRDAGTMRLEGAEIAPRSAGEATKLGIATVYQEVNLAPNLSVAQNL
FT                   FLGRQPTRLGFVREGEMRRRAQALLAEFGLSIDVAAPLETYSVAIRHIVAIARAVDQSA
FT                   RVLILDEPTASLDAHEVEVLFTVMRQLKARGIGIVFVTHFLDQVYAICDRITVLRNGRL
FT                   AGTAPIAELPRIDLVRMMLGRELSAATAQRPPRTAAAEAEPVAAFEDFGKAGYVAPFDL
FT                   TLRAGHVVGLAGLLGSGRTETVRLVFGAERADSGTAEVGGARVVLSSPHEAMRLGFGYC
FT                   PEERKTEGIVADLTVRENIVLALQAKRGPLKPLPRREQDDIAAKFIRLLDIRPPDPERP
FT                   VGLLSGGNQQKVLLARWLATAPRLLILDEPTRGIDVGAHAEIIGLIRDLCAEGMALLVV
FT                   SSELEEIVTYADEVVVLRDRAHVARLTGDEVDVPAILAAIAADAPASVAAPM"
     MHPTDGSLLE LTGFSKSFTG LMALDKVDFT LRRGEIHALL GENGAGKSTL IKTMTGVVTR        60
     DAGTMRLEGA EIAPRSAGEA TKLGIATVYQ EVNLAPNLSV AQNLFLGRQP TRLGFVREGE       120
     MRRRAQALLA EFGLSIDVAA PLETYSVAIR HIVAIARAVD QSARVLILDE PTASLDAHEV       180
     EVLFTVMRQL KARGIGIVFV THFLDQVYAI CDRITVLRNG RLAGTAPIAE LPRIDLVRMM       240
     LGRELSAATA QRPPRTAAAE AEPVAAFEDF GKAGYVAPFD LTLRAGHVVG LAGLLGSGRT       300
     ETVRLVFGAE RADSGTAEVG GARVVLSSPH EAMRLGFGYC PEERKTEGIV ADLTVRENIV       360
     LALQAKRGPL KPLPRREQDD IAAKFIRLLD IRPPDPERPV GLLSGGNQQK VLLARWLATA       420
     PRLLILDEPT RGIDVGAHAE IIGLIRDLCA EGMALLVVSS ELEEIVTYAD EVVVLRDRAH       480
     VARLTGDEVD VPAILAAIAA DAPASVAAPM                                        510
//

If you have problems or comments...

PBIL Back to PBIL home page