(data stored in ACNUC1104 zone)

EMBL: CP002026.PE126

CP002026.PE126       Location/Qualifiers
FT   CDS             complement(122646..123269)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snov_0126"
FT                   /product="maf protein"
FT                   /note="KEGG: rpd:RPD_4276 Maf-like protein; TIGRFAM: maf
FT                   protein; PFAM: Maf family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Snov_0126"
FT                   /db_xref="EnsemblGenomes-Tr:ADH87463"
FT                   /db_xref="GOA:D7A0V3"
FT                   /db_xref="InterPro:IPR003697"
FT                   /db_xref="InterPro:IPR029001"
FT                   /db_xref="UniProtKB/TrEMBL:D7A0V3"
FT                   /inference="protein motif:TFAM:TIGR00172"
FT                   /protein_id="ADH87463.1"
FT                   /translation="MSARPTLVLASGSPRRLALLAQAGIEPDALLPADIDEAPERGELP
FT                   RRLALRLAQQKLAAADARRKAGNEHEGAYLLAADTVVAVGRRILPKPDLSEEAADCLRL
FT                   LSGRAHRVYTGLALMTPKGGVRTRLVETRVRFKRLSREEMDGYVASREWLGKAGGYAIQ
FT                   GLAGVFVVKLVGSYTNVVGLPLAETVALLAGERFPVYQRWGNPE"
     MSARPTLVLA SGSPRRLALL AQAGIEPDAL LPADIDEAPE RGELPRRLAL RLAQQKLAAA        60
     DARRKAGNEH EGAYLLAADT VVAVGRRILP KPDLSEEAAD CLRLLSGRAH RVYTGLALMT       120
     PKGGVRTRLV ETRVRFKRLS REEMDGYVAS REWLGKAGGY AIQGLAGVFV VKLVGSYTNV       180
     VGLPLAETVA LLAGERFPVY QRWGNPE                                           207
//

If you have problems or comments...

PBIL Back to PBIL home page