(data stored in ACNUC1104 zone)

EMBL: CP002026.PE127

CP002026.PE127       Location/Qualifiers
FT   CDS             complement(123386..123877)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snov_0127"
FT                   /product="Protein-tyrosine phosphatase, low molecular
FT                   weight"
FT                   /note="KEGG: xau:Xaut_1233 protein tyrosine phosphatase;
FT                   PFAM: Protein-tyrosine phosphatase, low molecular weight;
FT                   SMART: Protein-tyrosine phosphatase, low molecular weight"
FT                   /db_xref="EnsemblGenomes-Gn:Snov_0127"
FT                   /db_xref="EnsemblGenomes-Tr:ADH87464"
FT                   /db_xref="InterPro:IPR023485"
FT                   /db_xref="InterPro:IPR036196"
FT                   /db_xref="UniProtKB/TrEMBL:D7A0V4"
FT                   /inference="protein motif:PFAM:PF01451"
FT                   /protein_id="ADH87464.1"
FT                   /translation="MATSAQSSLLVGPAVPGRKERPQSVLFMCGQNSVRSPMAAVLAKH
FT                   LFGRSLYVGSAGVAKGEPDPFVTAAIDEVGLDLHRHRPQTLEELEENEGLAFDLVITLS
FT                   PDAHHRALELTRTNAIDVEYWPTPDPTLVAGNREQQLDAYRAVRDELEARIRARFQRHV
FT                   "
     MATSAQSSLL VGPAVPGRKE RPQSVLFMCG QNSVRSPMAA VLAKHLFGRS LYVGSAGVAK        60
     GEPDPFVTAA IDEVGLDLHR HRPQTLEELE ENEGLAFDLV ITLSPDAHHR ALELTRTNAI       120
     DVEYWPTPDP TLVAGNREQQ LDAYRAVRDE LEARIRARFQ RHV                         163
//

If you have problems or comments...

PBIL Back to PBIL home page