(data stored in ACNUC1104 zone)

EMBL: CP002026.PE13

CP002026.PE13        Location/Qualifiers
FT   CDS             9663..10994
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snov_0013"
FT                   /product="phage portal protein, HK97 family"
FT                   /note="KEGG: bmj:BMULJ_04637 bacteriophage portal protein;
FT                   TIGRFAM: phage portal protein, HK97 family; PFAM: portal
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Snov_0013"
FT                   /db_xref="EnsemblGenomes-Tr:ADH87350"
FT                   /db_xref="InterPro:IPR006427"
FT                   /db_xref="InterPro:IPR006944"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZZT6"
FT                   /inference="protein motif:TFAM:TIGR01537"
FT                   /protein_id="ADH87350.1"
FT                   /translation="MRILDFFRRSEPAAAAGAHVSPQASGSGFLSLDDPRVIEFLRFGD
FT                   VTATGITVNVERALKNPAMFRAVSIISFAIGMLPLQLIHEETKKKATDHPLYRVLHRRP
FT                   NGWQSAFDFRTLMQLRALVKGNGYALVLRSTDLRNRGAEKVGGLVPLDPDRMEPKQLDD
FT                   WSVVYDYQPKTGARRRYQARDILHLRGLSLDGITGLSTVKQAAEPIALALAAELAAGRV
FT                   FKNGALVSGALKHPGKLSDPAFERLKASLAEKEGAENAGKNLILEEGMDWASVSSSAKD
FT                   AQLIEIRKMQIEEIGRATGVPRPLLMMDDTSWGSGIAELGRFFVQFALTPWFEAWQQAC
FT                   ERTLLSDAEADALTVKFNAGALLRGSVKDQGEFFAKALGAGGQPGFMTQNEVRDMLDMP
FT                   RVEGGDELSKGAMGHNGGPALDDPEDDTAPKPKRSPKKDEGDED"
     MRILDFFRRS EPAAAAGAHV SPQASGSGFL SLDDPRVIEF LRFGDVTATG ITVNVERALK        60
     NPAMFRAVSI ISFAIGMLPL QLIHEETKKK ATDHPLYRVL HRRPNGWQSA FDFRTLMQLR       120
     ALVKGNGYAL VLRSTDLRNR GAEKVGGLVP LDPDRMEPKQ LDDWSVVYDY QPKTGARRRY       180
     QARDILHLRG LSLDGITGLS TVKQAAEPIA LALAAELAAG RVFKNGALVS GALKHPGKLS       240
     DPAFERLKAS LAEKEGAENA GKNLILEEGM DWASVSSSAK DAQLIEIRKM QIEEIGRATG       300
     VPRPLLMMDD TSWGSGIAEL GRFFVQFALT PWFEAWQQAC ERTLLSDAEA DALTVKFNAG       360
     ALLRGSVKDQ GEFFAKALGA GGQPGFMTQN EVRDMLDMPR VEGGDELSKG AMGHNGGPAL       420
     DDPEDDTAPK PKRSPKKDEG DED                                               443
//

If you have problems or comments...

PBIL Back to PBIL home page