(data stored in ACNUC1104 zone)

EMBL: CP002026.PE131

CP002026.PE131       Location/Qualifiers
FT   CDS             complement(126458..127747)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snov_0131"
FT                   /product="UDP-N-acetylglucosamine
FT                   1-carboxyvinyltransferase"
FT                   /note="KEGG: azc:AZC_3151 UDP-N-acetylglucosamine
FT                   1-carboxyvinyltransferase; TIGRFAM: UDP-N-acetylglucosamine
FT                   1-carboxyvinyltransferase; PFAM: EPSP synthase
FT                   (3-phosphoshikimate 1-carboxyvinyltransferase)"
FT                   /db_xref="EnsemblGenomes-Gn:Snov_0131"
FT                   /db_xref="EnsemblGenomes-Tr:ADH87468"
FT                   /db_xref="GOA:D7A0V8"
FT                   /db_xref="InterPro:IPR001986"
FT                   /db_xref="InterPro:IPR005750"
FT                   /db_xref="InterPro:IPR013792"
FT                   /db_xref="InterPro:IPR036968"
FT                   /db_xref="UniProtKB/TrEMBL:D7A0V8"
FT                   /inference="protein motif:TFAM:TIGR01072"
FT                   /protein_id="ADH87468.1"
FT                   /translation="MDRIRIVGGNPLTGSIPISGAKNAALPLMIAGLLTDEKLVLHNVP
FT                   RLADVSQLQRILGNHGIDITVNGKRRGDDPYSGQTMEIDARVIVDTTAPYELVSKMRAS
FT                   FWVIGPLVARMGEAKVSLPGGCAIGTRPVDFHLDALRALGAEIEIDAGYVLARAPKGLK
FT                   GAHILFPKVSVGATHTAMMAASLAEGETILENAAREPEIVDVADCINAMGGRIEGQGTS
FT                   TIRITGVPRLKGAHHSVLPDRIETGTYAMAVAMTGGDVMLSGARADLLDSALDTLRECG
FT                   AEVTVSNEGLRVKRNGAGISPVEVTTAPFPGFPTDLQAQLMALTTRARGTSKITETIFE
FT                   NRFMHVQELARLGARIHLDGEIATIEGVEKLKGAPVMATDLRASVSLVIGALAAEGESM
FT                   IHRVYHLDRGFERLEEKLSACGAEIERLAG"
     MDRIRIVGGN PLTGSIPISG AKNAALPLMI AGLLTDEKLV LHNVPRLADV SQLQRILGNH        60
     GIDITVNGKR RGDDPYSGQT MEIDARVIVD TTAPYELVSK MRASFWVIGP LVARMGEAKV       120
     SLPGGCAIGT RPVDFHLDAL RALGAEIEID AGYVLARAPK GLKGAHILFP KVSVGATHTA       180
     MMAASLAEGE TILENAAREP EIVDVADCIN AMGGRIEGQG TSTIRITGVP RLKGAHHSVL       240
     PDRIETGTYA MAVAMTGGDV MLSGARADLL DSALDTLREC GAEVTVSNEG LRVKRNGAGI       300
     SPVEVTTAPF PGFPTDLQAQ LMALTTRARG TSKITETIFE NRFMHVQELA RLGARIHLDG       360
     EIATIEGVEK LKGAPVMATD LRASVSLVIG ALAAEGESMI HRVYHLDRGF ERLEEKLSAC       420
     GAEIERLAG                                                               429
//

If you have problems or comments...

PBIL Back to PBIL home page