(data stored in ACNUC1104 zone)

EMBL: CP002026.PE141

CP002026.PE141       Location/Qualifiers
FT   CDS             136468..137793
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snov_0141"
FT                   /product="integral membrane sensor signal transduction
FT                   histidine kinase"
FT                   /note="KEGG: ara:Arad_0229 two-component sensor histidine
FT                   kinase protein; PFAM: ATP-binding region ATPase domain
FT                   protein; histidine kinase HAMP region domain protein;
FT                   histidine kinase A domain protein; SMART: ATP-binding
FT                   region ATPase domain protein; histidine kinase HAMP region
FT                   domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Snov_0141"
FT                   /db_xref="EnsemblGenomes-Tr:ADH87478"
FT                   /db_xref="GOA:D7A0W8"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:D7A0W8"
FT                   /inference="protein motif:PFAM:PF02518"
FT                   /protein_id="ADH87478.1"
FT                   /translation="MRLGLLARIILIVAVALFAIQLLALFFYFGAGEGRRTLGEGSPSL
FT                   SRQVASLVLLVDKVPADLRPALLEAFSENGRTATIVPALPDDFTRTNGLIRIERSIRAA
FT                   LALRGAEGRQVWARLEGRSESGRGDTLSVYVELADGGYLWLDVEDRVTVRLLGVPIGFF
FT                   AGLFGVIVALAALVAVAREMRPITRLAREVDRVGEGIDPVAIPERGAPELRKLIRAVNA
FT                   MQKRIAALVRNRTLTLGAISHDLRTYLTRLRLRVEMMPESRHRAGAIADVEAMQALVAD
FT                   TLDFAQDSFVPTEPVRADLATALRRYAAEQNDARIVLDVPDGPVHVAMGDKALGRVVAN
FT                   LVGNALRYGERAFAGIKTGGARVVLVIEDEGPGIPAEERERVFEPFHRLEASRNRDSGG
FT                   TGLGLTIVRRLVERHGGSIELGTSRRGGLAVRVMLPRTEPPA"
     MRLGLLARII LIVAVALFAI QLLALFFYFG AGEGRRTLGE GSPSLSRQVA SLVLLVDKVP        60
     ADLRPALLEA FSENGRTATI VPALPDDFTR TNGLIRIERS IRAALALRGA EGRQVWARLE       120
     GRSESGRGDT LSVYVELADG GYLWLDVEDR VTVRLLGVPI GFFAGLFGVI VALAALVAVA       180
     REMRPITRLA REVDRVGEGI DPVAIPERGA PELRKLIRAV NAMQKRIAAL VRNRTLTLGA       240
     ISHDLRTYLT RLRLRVEMMP ESRHRAGAIA DVEAMQALVA DTLDFAQDSF VPTEPVRADL       300
     ATALRRYAAE QNDARIVLDV PDGPVHVAMG DKALGRVVAN LVGNALRYGE RAFAGIKTGG       360
     ARVVLVIEDE GPGIPAEERE RVFEPFHRLE ASRNRDSGGT GLGLTIVRRL VERHGGSIEL       420
     GTSRRGGLAV RVMLPRTEPP A                                                 441
//

If you have problems or comments...

PBIL Back to PBIL home page