(data stored in ACNUC1104 zone)

EMBL: CP002026.PE142

CP002026.PE142       Location/Qualifiers
FT   CDS             137877..138461
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snov_0142"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: pde:Pden_3440 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Snov_0142"
FT                   /db_xref="EnsemblGenomes-Tr:ADH87479"
FT                   /db_xref="UniProtKB/TrEMBL:D7A0W9"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADH87479.1"
FT                   /translation="MRKIFPSTLSTRIAGGAVVLALVAAGAVPTLGIAQDLAGPLAAPA
FT                   GAAGPWACEVPPFAAGPGPAIDPAAARLIAGMLLSAQETALGIRTDQMDAWRGYTTALI
FT                   ALLPSGERLGRWTDEKKRAEAQAFDLAQDIAGAAIERAEKARALQDAVSKLKTVLTPEQ
FT                   MSMAKQMQEKLVERIVRFVQWRRGEGSGVPL"
     MRKIFPSTLS TRIAGGAVVL ALVAAGAVPT LGIAQDLAGP LAAPAGAAGP WACEVPPFAA        60
     GPGPAIDPAA ARLIAGMLLS AQETALGIRT DQMDAWRGYT TALIALLPSG ERLGRWTDEK       120
     KRAEAQAFDL AQDIAGAAIE RAEKARALQD AVSKLKTVLT PEQMSMAKQM QEKLVERIVR       180
     FVQWRRGEGS GVPL                                                         194
//

If you have problems or comments...

PBIL Back to PBIL home page