(data stored in ACNUC1104 zone)

EMBL: CP002026.PE144

CP002026.PE144       Location/Qualifiers
FT   CDS             complement(139464..140150)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snov_0144"
FT                   /product="putative signal transduction protein with CBS
FT                   domains"
FT                   /note="KEGG: nha:Nham_1933 CBS domain-containing protein;
FT                   PFAM: CBS domain containing protein; transport-associated;
FT                   SMART: CBS domain containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:Snov_0144"
FT                   /db_xref="EnsemblGenomes-Tr:ADH87481"
FT                   /db_xref="InterPro:IPR000644"
FT                   /db_xref="InterPro:IPR007055"
FT                   /db_xref="InterPro:IPR017080"
FT                   /db_xref="UniProtKB/TrEMBL:D7A0X1"
FT                   /inference="protein motif:PFAM:PF00571"
FT                   /protein_id="ADH87481.1"
FT                   /translation="MKARDVMTSPVITAKATDLVVQIAKTLLERRISGMPIVDDKGKMV
FT                   GIISEGDLIRRAEAGTERRRSWWLQAFVDDGTLAAEYVKAHGRTAADVMHRDPVTAGPD
FT                   TPLHEIAALMESHGVKRIPIVEKGHLVGIVSRSNLIQAVAGTKMGLEIPLSDSAIREKV
FT                   MERLNQQPWANTWRLNVTVDDGVVNLWGIANADTERQALRVVAETTPGVRAVNDHLMKE
FT                   PMGSWA"
     MKARDVMTSP VITAKATDLV VQIAKTLLER RISGMPIVDD KGKMVGIISE GDLIRRAEAG        60
     TERRRSWWLQ AFVDDGTLAA EYVKAHGRTA ADVMHRDPVT AGPDTPLHEI AALMESHGVK       120
     RIPIVEKGHL VGIVSRSNLI QAVAGTKMGL EIPLSDSAIR EKVMERLNQQ PWANTWRLNV       180
     TVDDGVVNLW GIANADTERQ ALRVVAETTP GVRAVNDHLM KEPMGSWA                    228
//

If you have problems or comments...

PBIL Back to PBIL home page