(data stored in ACNUC1104 zone)

EMBL: CP002026.PE147

CP002026.PE147       Location/Qualifiers
FT   CDS             complement(143105..143437)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snov_0148"
FT                   /product="conserved hypothetical protein; putative exported
FT                   protein"
FT                   /note="KEGG: cti:RALTA_B0044 conserved hypothetical
FT                   protein; putative exported protein"
FT                   /db_xref="EnsemblGenomes-Gn:Snov_0148"
FT                   /db_xref="EnsemblGenomes-Tr:ADH87484"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="InterPro:IPR024447"
FT                   /db_xref="UniProtKB/TrEMBL:D7A0X4"
FT                   /inference="similar to AA sequence:KEGG:RALTA_B0044"
FT                   /protein_id="ADH87484.1"
FT                   /translation="MLSRRSLFKGLLAAALAAPAGAALTSTADAQWGVPGPRMAPPPPR
FT                   REPRPRPRRGYTWVPGHWNWSARRGWVWAPGHWEENRRGFTYVGPRWVFRRGQWVFEPG
FT                   RWVRSW"
     MLSRRSLFKG LLAAALAAPA GAALTSTADA QWGVPGPRMA PPPPRREPRP RPRRGYTWVP        60
     GHWNWSARRG WVWAPGHWEE NRRGFTYVGP RWVFRRGQWV FEPGRWVRSW                  110
//

If you have problems or comments...

PBIL Back to PBIL home page