(data stored in ACNUC1104 zone)

EMBL: CP002026.PE148

CP002026.PE148       Location/Qualifiers
FT   CDS             complement(143459..144664)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snov_0149"
FT                   /product="sodium/glutamate symporter"
FT                   /note="KEGG: msl:Msil_1050 sodium/glutamate symporter;
FT                   TIGRFAM: sodium/glutamate symporter; PFAM: sodium/glutamate
FT                   symporter"
FT                   /db_xref="EnsemblGenomes-Gn:Snov_0149"
FT                   /db_xref="EnsemblGenomes-Tr:ADH87485"
FT                   /db_xref="GOA:D7A0X5"
FT                   /db_xref="InterPro:IPR004445"
FT                   /db_xref="UniProtKB/TrEMBL:D7A0X5"
FT                   /inference="protein motif:TFAM:TIGR00210"
FT                   /protein_id="ADH87485.1"
FT                   /translation="MASIQVSGLLTFTVAILVFFAGSGLNRLIAPLRAWNIPEAVTGGL
FT                   LAATVTLLAYRLLGAEISFALQARDMLLLYFFTGIGLNARLDDLISGGRPLIILLALTV
FT                   VFLVIQNFIAIGAVAALGLPEGLTVFLGSASLIGGHGTTIAWAPLISQRFGVPNAMEIG
FT                   IASATLGLVLASLAGGPIARHLIGRYKLHGPAYGDAAVGLPAKAENSPADDIGHVSLLR
FT                   TVLVLNVAILIGFGLEGVVEETGIKLPMFVVCLLVGIVLTNTVPRLFSRLLWPTRTRAL
FT                   ALVSDLSLNIFLAMSLMSMQLWTIGGLGLALVIVLAVQTVAAVAYIIFVVFPLMGRDYQ
FT                   AAVIAAGFTGISLGATPTAIANMTAITKTHGAAPRAFIILPLVSAFFIDIINAAAIGFL
FT                   AR"
     MASIQVSGLL TFTVAILVFF AGSGLNRLIA PLRAWNIPEA VTGGLLAATV TLLAYRLLGA        60
     EISFALQARD MLLLYFFTGI GLNARLDDLI SGGRPLIILL ALTVVFLVIQ NFIAIGAVAA       120
     LGLPEGLTVF LGSASLIGGH GTTIAWAPLI SQRFGVPNAM EIGIASATLG LVLASLAGGP       180
     IARHLIGRYK LHGPAYGDAA VGLPAKAENS PADDIGHVSL LRTVLVLNVA ILIGFGLEGV       240
     VEETGIKLPM FVVCLLVGIV LTNTVPRLFS RLLWPTRTRA LALVSDLSLN IFLAMSLMSM       300
     QLWTIGGLGL ALVIVLAVQT VAAVAYIIFV VFPLMGRDYQ AAVIAAGFTG ISLGATPTAI       360
     ANMTAITKTH GAAPRAFIIL PLVSAFFIDI INAAAIGFLA R                           401
//

If you have problems or comments...

PBIL Back to PBIL home page