(data stored in ACNUC1104 zone)

EMBL: CP002026.PE150

CP002026.PE150       Location/Qualifiers
FT   CDS             complement(146151..147257)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snov_0151"
FT                   /product="Patatin"
FT                   /note="PFAM: Patatin; KEGG: azc:AZC_1304 putative esterase"
FT                   /db_xref="EnsemblGenomes-Gn:Snov_0151"
FT                   /db_xref="EnsemblGenomes-Tr:ADH87487"
FT                   /db_xref="GOA:D7A0X7"
FT                   /db_xref="InterPro:IPR002641"
FT                   /db_xref="InterPro:IPR016035"
FT                   /db_xref="UniProtKB/TrEMBL:D7A0X7"
FT                   /inference="protein motif:PFAM:PF01734"
FT                   /protein_id="ADH87487.1"
FT                   /translation="MPRPTSATRARRPSGADNAPSPNAEPATDARRAPVLIDLALQGGG
FT                   SHGAFTWGVLDRLLEEEWLRIDGVSGTSAGAMNAAVMADGYAAGGAAGARAALDAYWRH
FT                   VAEAARFSPFQRGPLDVLFGRWTLDHSPMFIAMDLMSRLYSPYDLNPAGTNPLRDILEK
FT                   AIDFDRLKTSPIKVFITATNVRTGRGRVFRNAEITPDVLLASACLPTLFQAVEIDGESY
FT                   WDGGYAGNPTMTPLVRELDSDDTILIPINPIERPGTPRSAAEILNRLNEVSFNSALLKE
FT                   LRMIALLRQVADPGHSEGAQWAKMRIHLVRNEIMATLGYSSKLNAGWDFLSMLREEGRK
FT                   AAQAFLDADADNIGKRSSVDLDVLLEGV"
     MPRPTSATRA RRPSGADNAP SPNAEPATDA RRAPVLIDLA LQGGGSHGAF TWGVLDRLLE        60
     EEWLRIDGVS GTSAGAMNAA VMADGYAAGG AAGARAALDA YWRHVAEAAR FSPFQRGPLD       120
     VLFGRWTLDH SPMFIAMDLM SRLYSPYDLN PAGTNPLRDI LEKAIDFDRL KTSPIKVFIT       180
     ATNVRTGRGR VFRNAEITPD VLLASACLPT LFQAVEIDGE SYWDGGYAGN PTMTPLVREL       240
     DSDDTILIPI NPIERPGTPR SAAEILNRLN EVSFNSALLK ELRMIALLRQ VADPGHSEGA       300
     QWAKMRIHLV RNEIMATLGY SSKLNAGWDF LSMLREEGRK AAQAFLDADA DNIGKRSSVD       360
     LDVLLEGV                                                                368
//

If you have problems or comments...

PBIL Back to PBIL home page