(data stored in ACNUC1104 zone)

EMBL: CP002026.PE152

CP002026.PE152       Location/Qualifiers
FT   CDS             149028..150263
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snov_0153"
FT                   /product="arginine deiminase"
FT                   /EC_number="3.5.3.6"
FT                   /note="TIGRFAM: arginine deiminase; KEGG: mlo:mll6733
FT                   arginine deiminase; PFAM: amidinotransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Snov_0153"
FT                   /db_xref="EnsemblGenomes-Tr:ADH87489"
FT                   /db_xref="GOA:D7A0X9"
FT                   /db_xref="InterPro:IPR003876"
FT                   /db_xref="UniProtKB/TrEMBL:D7A0X9"
FT                   /inference="protein motif:TFAM:TIGR01078"
FT                   /protein_id="ADH87489.1"
FT                   /translation="METSFGVHSEVGQLRKVLVCAPGRAHQRLTPSNCDALLFDDVLWV
FT                   DVAKRDHFDFITKMRDRGIEVVEMHNLLTETLAVPEAKKWILDNQVAPNQIGLGFVEEV
FT                   RSYLEGLPNRQLAETLIGGLSTYEFPETIGGETLALIRDAAGVNEYLLPPLPNTLYTRD
FT                   TTCWIYGGVTLNPLYWPARHEETILTSSIYKFHPDFAGKVNVWWGDPTKDWGLATLEGG
FT                   DVMPIGKGNVLIGMSERTSRQAISQAAAALFEKGGAERVIVAAMPKLRAAMHLDTVFTF
FT                   ADRDCVLIYPDIVDKIECFSYRPDGKGGVELSRDKGLIETVKEALGLKEIRVVETGGND
FT                   YMRERTQWDSGANLVCASPGVVFAYDRNTYANTLLRKAGIEVITIDGSELGRGRGGGHC
FT                   MTCPIIRDAVDF"
     METSFGVHSE VGQLRKVLVC APGRAHQRLT PSNCDALLFD DVLWVDVAKR DHFDFITKMR        60
     DRGIEVVEMH NLLTETLAVP EAKKWILDNQ VAPNQIGLGF VEEVRSYLEG LPNRQLAETL       120
     IGGLSTYEFP ETIGGETLAL IRDAAGVNEY LLPPLPNTLY TRDTTCWIYG GVTLNPLYWP       180
     ARHEETILTS SIYKFHPDFA GKVNVWWGDP TKDWGLATLE GGDVMPIGKG NVLIGMSERT       240
     SRQAISQAAA ALFEKGGAER VIVAAMPKLR AAMHLDTVFT FADRDCVLIY PDIVDKIECF       300
     SYRPDGKGGV ELSRDKGLIE TVKEALGLKE IRVVETGGND YMRERTQWDS GANLVCASPG       360
     VVFAYDRNTY ANTLLRKAGI EVITIDGSEL GRGRGGGHCM TCPIIRDAVD F                411
//

If you have problems or comments...

PBIL Back to PBIL home page