(data stored in ACNUC1104 zone)

EMBL: CP002026.PE154

CP002026.PE154       Location/Qualifiers
FT   CDS             complement(151308..152345)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snov_0155"
FT                   /product="Proline racemase"
FT                   /EC_number="5.1.1.4"
FT                   /note="KEGG: rlt:Rleg2_2641 proline racemase; PFAM: proline
FT                   racemase"
FT                   /db_xref="EnsemblGenomes-Gn:Snov_0155"
FT                   /db_xref="EnsemblGenomes-Tr:ADH87491"
FT                   /db_xref="GOA:D7A0Y1"
FT                   /db_xref="InterPro:IPR008794"
FT                   /db_xref="UniProtKB/Swiss-Prot:D7A0Y1"
FT                   /inference="protein motif:PRIAM:5.1.1.4"
FT                   /protein_id="ADH87491.1"
FT                   /translation="MRSSKVIHVVGCHAEGEVGDVIVGGVAPPPGETVWAQSRFVASDN
FT                   TLRNFVLQEPRGGVFRHVNLLVPPKNKEAVAAWIIMEPEDTPPMSGSNSICVSTVLLDT
FT                   GIVPMVEPETHMVLEAPGGLIEATAYCKNGKAERIRVKNHPSFADKLDAKLELEGYGTL
FT                   TVDTAYGGDSFCIVDAHALGFSIKPDEAKDFADLGMKIVKAANQQLGFQHPTNKDWSHI
FT                   SFCQFAAPLTDDNGTPSGANAVAIRPGKIDRSPCGTGCSARMAVLHAKGILKVGDAFVG
FT                   RSIIGSRFDCRVEAETSIGGRPAIVPSIMGRAFITHTAQLMVDPDDPWQTGYRLSDTWP
FT                   VWKQD"
     MRSSKVIHVV GCHAEGEVGD VIVGGVAPPP GETVWAQSRF VASDNTLRNF VLQEPRGGVF        60
     RHVNLLVPPK NKEAVAAWII MEPEDTPPMS GSNSICVSTV LLDTGIVPMV EPETHMVLEA       120
     PGGLIEATAY CKNGKAERIR VKNHPSFADK LDAKLELEGY GTLTVDTAYG GDSFCIVDAH       180
     ALGFSIKPDE AKDFADLGMK IVKAANQQLG FQHPTNKDWS HISFCQFAAP LTDDNGTPSG       240
     ANAVAIRPGK IDRSPCGTGC SARMAVLHAK GILKVGDAFV GRSIIGSRFD CRVEAETSIG       300
     GRPAIVPSIM GRAFITHTAQ LMVDPDDPWQ TGYRLSDTWP VWKQD                       345
//

If you have problems or comments...

PBIL Back to PBIL home page