(data stored in ACNUC1104 zone)

EMBL: CP002026.PE156

CP002026.PE156       Location/Qualifiers
FT   CDS             complement(153692..154693)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snov_0157"
FT                   /product="4-hydroxyproline epimerase"
FT                   /EC_number="5.1.1.8"
FT                   /note="KEGG: sme:SM_b20268 hydroxyproline-2-epimerase;
FT                   PFAM: proline racemase"
FT                   /db_xref="EnsemblGenomes-Gn:Snov_0157"
FT                   /db_xref="EnsemblGenomes-Tr:ADH87493"
FT                   /db_xref="GOA:D7A0Y3"
FT                   /db_xref="InterPro:IPR008794"
FT                   /db_xref="UniProtKB/Swiss-Prot:D7A0Y3"
FT                   /inference="protein motif:PRIAM:5.1.1.8"
FT                   /protein_id="ADH87493.1"
FT                   /translation="MARHSFFCIDGHTCGNPVRLVAGGGPNLQGANMIEKRAHFLAEYD
FT                   WIRTGLMFEPRGHDMMSGSILYPPTRPDCDVAILFIETSGCLPMCGHGTIGTVTMAIEH
FT                   GLVTPKIPGVLMLDTPAGVVKAEYRQEGQYVEEVRITNVPAFLYARGLTAECPGLGEVM
FT                   VDVAYGGNFYAIVEPQEHFRDMADFTAGELIGMSGALRKALNAKYEFVHPEKPEIRGLS
FT                   HILWTGAPKHAEAHARNAVFYGDKAIDRSPCGTGTSARIAHWAANGKLKVGDDFVHESI
FT                   IGSLFKGRVEATARVGNVDAIIPSIGGWARMTGYNTIFIDDRDPFAHGFVVV"
     MARHSFFCID GHTCGNPVRL VAGGGPNLQG ANMIEKRAHF LAEYDWIRTG LMFEPRGHDM        60
     MSGSILYPPT RPDCDVAILF IETSGCLPMC GHGTIGTVTM AIEHGLVTPK IPGVLMLDTP       120
     AGVVKAEYRQ EGQYVEEVRI TNVPAFLYAR GLTAECPGLG EVMVDVAYGG NFYAIVEPQE       180
     HFRDMADFTA GELIGMSGAL RKALNAKYEF VHPEKPEIRG LSHILWTGAP KHAEAHARNA       240
     VFYGDKAIDR SPCGTGTSAR IAHWAANGKL KVGDDFVHES IIGSLFKGRV EATARVGNVD       300
     AIIPSIGGWA RMTGYNTIFI DDRDPFAHGF VVV                                    333
//

If you have problems or comments...

PBIL Back to PBIL home page