(data stored in ACNUC1104 zone)

EMBL: CP002026.PE157

CP002026.PE157       Location/Qualifiers
FT   CDS             complement(154706..155959)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snov_0158"
FT                   /product="FAD dependent oxidoreductase"
FT                   /note="PFAM: FAD dependent oxidoreductase; KEGG:
FT                   bmc:BAbS19_I16830 TrkA potassium uptake protein"
FT                   /db_xref="EnsemblGenomes-Gn:Snov_0158"
FT                   /db_xref="EnsemblGenomes-Tr:ADH87494"
FT                   /db_xref="GOA:D7A0Y4"
FT                   /db_xref="InterPro:IPR006076"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:D7A0Y4"
FT                   /inference="protein motif:PFAM:PF01266"
FT                   /protein_id="ADH87494.1"
FT                   /translation="MSDRADSGEIAVIGAGIVGLACAFHLLGEGHRVRLVERGGVAEGA
FT                   SFGNAGAFAFTDILPLASPGMLLKAPKWLFDPLGPLSIPPRYLPQITPWLIRFWRASLP
FT                   DRYRHSLVAQGSLMRFAAQAMESMVAAAGLSSHVRRDGNLQLYESEAELAASQPGWDAR
FT                   AKEGVEFEHVRGSRLAELQPGVAPRFVAGTFTPRWQTVDDPHHFALALFQAVMARGAAI
FT                   THGEVKAVEPAESGVRLRLADGSQLAVGRAILAGGAWSRPLARELGDAIPLETERGYNT
FT                   TLPPGAFALHRQLTFGGHGFVVTPLSTGIRVGGAVELGGLKAAPNFRRSEVMLRKAAAF
FT                   LPGLNTEGGTQWMGFRPSLPDSLPVIGTSRASNRVLYAFGHGHLGLTQSAATGRLVADM
FT                   VAGRTPSITLDPFRPDRF"
     MSDRADSGEI AVIGAGIVGL ACAFHLLGEG HRVRLVERGG VAEGASFGNA GAFAFTDILP        60
     LASPGMLLKA PKWLFDPLGP LSIPPRYLPQ ITPWLIRFWR ASLPDRYRHS LVAQGSLMRF       120
     AAQAMESMVA AAGLSSHVRR DGNLQLYESE AELAASQPGW DARAKEGVEF EHVRGSRLAE       180
     LQPGVAPRFV AGTFTPRWQT VDDPHHFALA LFQAVMARGA AITHGEVKAV EPAESGVRLR       240
     LADGSQLAVG RAILAGGAWS RPLARELGDA IPLETERGYN TTLPPGAFAL HRQLTFGGHG       300
     FVVTPLSTGI RVGGAVELGG LKAAPNFRRS EVMLRKAAAF LPGLNTEGGT QWMGFRPSLP       360
     DSLPVIGTSR ASNRVLYAFG HGHLGLTQSA ATGRLVADMV AGRTPSITLD PFRPDRF          417
//

If you have problems or comments...

PBIL Back to PBIL home page