(data stored in ACNUC1104 zone)

EMBL: CP002026.PE158

CP002026.PE158       Location/Qualifiers
FT   CDS             complement(156098..156994)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snov_0159"
FT                   /product="dihydrodipicolinate synthetase"
FT                   /note="PFAM: dihydrodipicolinate synthetase; KEGG:
FT                   mlo:mll3981 dihydrodipicolinate synthase"
FT                   /db_xref="EnsemblGenomes-Gn:Snov_0159"
FT                   /db_xref="EnsemblGenomes-Tr:ADH87495"
FT                   /db_xref="GOA:D7A0Y5"
FT                   /db_xref="InterPro:IPR002220"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniProtKB/TrEMBL:D7A0Y5"
FT                   /inference="protein motif:PFAM:PF00701"
FT                   /protein_id="ADH87495.1"
FT                   /translation="MWQGIYPAVTAKFNEDDSLDHKEMEKSFAFQIEAGVDGLIVNGSL
FT                   GEGPMLSHDERLAVLKTAKSVAGKKPVLMTIADSSTRDCASLAKRAAAAGADGLMTVPS
FT                   LVYHTNPKETVAALSAVAQAADLPVMIYSNRLAYRVDVTVEIMAELAKDKRFVAVKESS
FT                   DDIRRTIDIFNAFGDRYDVFTGVDNLAYEALAVGAVGWVAGLVVAFPHETVAIYKLMKA
FT                   KRYDEALAIYRWFRPLLDLDVSTYLVQNLKLVEALVTGTTERVRSPRLMLEGEQRAKVE
FT                   KIVAEALATRPALAKAA"
     MWQGIYPAVT AKFNEDDSLD HKEMEKSFAF QIEAGVDGLI VNGSLGEGPM LSHDERLAVL        60
     KTAKSVAGKK PVLMTIADSS TRDCASLAKR AAAAGADGLM TVPSLVYHTN PKETVAALSA       120
     VAQAADLPVM IYSNRLAYRV DVTVEIMAEL AKDKRFVAVK ESSDDIRRTI DIFNAFGDRY       180
     DVFTGVDNLA YEALAVGAVG WVAGLVVAFP HETVAIYKLM KAKRYDEALA IYRWFRPLLD       240
     LDVSTYLVQN LKLVEALVTG TTERVRSPRL MLEGEQRAKV EKIVAEALAT RPALAKAA         298
//

If you have problems or comments...

PBIL Back to PBIL home page