(data stored in ACNUC1104 zone)

EMBL: CP002026.PE159

CP002026.PE159       Location/Qualifiers
FT   CDS             complement(157031..157756)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snov_0160"
FT                   /product="ABC transporter related protein"
FT                   /note="KEGG: pae:PA1256 amino acid ABC transporter ATP
FT                   binding protein; PFAM: ABC transporter related; SMART: AAA
FT                   ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Snov_0160"
FT                   /db_xref="EnsemblGenomes-Tr:ADH87496"
FT                   /db_xref="GOA:D7A0Y6"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR030679"
FT                   /db_xref="UniProtKB/TrEMBL:D7A0Y6"
FT                   /inference="protein motif:PFAM:PF00005"
FT                   /protein_id="ADH87496.1"
FT                   /translation="MSILIDDVHKSFGSLEVIKGVTMTVEKGEVVSVIGGSGSGKSTLL
FT                   MCINGLEPINSGRILVDGTDVHARGTDLNKLRRKIGIVFQQWNAFPHLTVLENVMLAPR
FT                   KVLGKSKAEAQAVAVEKLTHVGLAEKLNVYPSKLSGGQQQRMAIARALAMSPDYMLFDE
FT                   VTSALDPQLVGEVLDTMRLLSKEGMTMIVVTHEIAFAREVSDRVAFFHKGRIHEIGPPS
FT                   QVIGNPQQPETVAFLKSVL"
     MSILIDDVHK SFGSLEVIKG VTMTVEKGEV VSVIGGSGSG KSTLLMCING LEPINSGRIL        60
     VDGTDVHARG TDLNKLRRKI GIVFQQWNAF PHLTVLENVM LAPRKVLGKS KAEAQAVAVE       120
     KLTHVGLAEK LNVYPSKLSG GQQQRMAIAR ALAMSPDYML FDEVTSALDP QLVGEVLDTM       180
     RLLSKEGMTM IVVTHEIAFA REVSDRVAFF HKGRIHEIGP PSQVIGNPQQ PETVAFLKSV       240
     L                                                                       241
//

If you have problems or comments...

PBIL Back to PBIL home page