(data stored in ACNUC1104 zone)

EMBL: CP002026.PE160

CP002026.PE160       Location/Qualifiers
FT   CDS             complement(157766..158431)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snov_0161"
FT                   /product="polar amino acid ABC transporter, inner membrane
FT                   subunit"
FT                   /note="KEGG: atc:AGR_L_403 probable permease of ABC
FT                   transporter; TIGRFAM: polar amino acid ABC transporter,
FT                   inner membrane subunit; PFAM: binding-protein-dependent
FT                   transport systems inner membrane component"
FT                   /db_xref="EnsemblGenomes-Gn:Snov_0161"
FT                   /db_xref="EnsemblGenomes-Tr:ADH87497"
FT                   /db_xref="GOA:D7A0Y7"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR010065"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:D7A0Y7"
FT                   /inference="protein motif:TFAM:TIGR01726"
FT                   /protein_id="ADH87497.1"
FT                   /translation="MFSSLLDTSFSLGDLWFMLKGAGVTLALTAWAVLGGTLLGVLFGV
FT                   IRAISPWWINAPIGAVLDVFRSVPLLIQLVLANSFKTIVGINWAPFTVSCVVLALYMSA
FT                   YCTEIVRSGFLAVPSTTRRAARSLGMTWRQDLTDIVFPIALRVALPSWIGLTLGVMKDT
FT                   AMVWWIGVVELLRSSQVIVTRIQEPLFVLSIAGLIYFLMSFPIARLGARLEARWREND"
     MFSSLLDTSF SLGDLWFMLK GAGVTLALTA WAVLGGTLLG VLFGVIRAIS PWWINAPIGA        60
     VLDVFRSVPL LIQLVLANSF KTIVGINWAP FTVSCVVLAL YMSAYCTEIV RSGFLAVPST       120
     TRRAARSLGM TWRQDLTDIV FPIALRVALP SWIGLTLGVM KDTAMVWWIG VVELLRSSQV       180
     IVTRIQEPLF VLSIAGLIYF LMSFPIARLG ARLEARWREN D                           221
//

If you have problems or comments...

PBIL Back to PBIL home page