(data stored in ACNUC1104 zone)

EMBL: CP002026.PE161

CP002026.PE161       Location/Qualifiers
FT   CDS             complement(158444..159106)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snov_0162"
FT                   /product="polar amino acid ABC transporter, inner membrane
FT                   subunit"
FT                   /note="KEGG: pap:PSPA7_4134 ABC transporter permease;
FT                   TIGRFAM: polar amino acid ABC transporter, inner membrane
FT                   subunit; PFAM: binding-protein-dependent transport systems
FT                   inner membrane component"
FT                   /db_xref="EnsemblGenomes-Gn:Snov_0162"
FT                   /db_xref="EnsemblGenomes-Tr:ADH87498"
FT                   /db_xref="GOA:D7A0Y8"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR010065"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:D7A0Y8"
FT                   /inference="protein motif:TFAM:TIGR01726"
FT                   /protein_id="ADH87498.1"
FT                   /translation="MHYTFHWLPAFRALPDMLWGALVTLEIAVLSMLLGVFFAVLLAVA
FT                   SGSQYRALRALASTWVELARNTPALFQIYMAYFGLGSLGIHLDSFPALLAGITFNNAGY
FT                   LAETFRGGLRAVPPTQVRAARSLGMGQIQAFRLIVMPQMFRVVFYPMTNQMVWAILMTS
FT                   LGVIVGLNNDLTGVTQELNVRSFRTFEYFALAAVIYYLLAKLVTLSARLMAWRLFRY"
     MHYTFHWLPA FRALPDMLWG ALVTLEIAVL SMLLGVFFAV LLAVASGSQY RALRALASTW        60
     VELARNTPAL FQIYMAYFGL GSLGIHLDSF PALLAGITFN NAGYLAETFR GGLRAVPPTQ       120
     VRAARSLGMG QIQAFRLIVM PQMFRVVFYP MTNQMVWAIL MTSLGVIVGL NNDLTGVTQE       180
     LNVRSFRTFE YFALAAVIYY LLAKLVTLSA RLMAWRLFRY                             220
//

If you have problems or comments...

PBIL Back to PBIL home page