(data stored in ACNUC1104 zone)

EMBL: CP002026.PE162

CP002026.PE162       Location/Qualifiers
FT   CDS             complement(159399..160211)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snov_0163"
FT                   /product="extracellular solute-binding protein family 3"
FT                   /note="KEGG: atc:AGR_L_407 probable binding protein
FT                   component of ABC transporter; PFAM: extracellular
FT                   solute-binding protein family 3; SMART: extracellular
FT                   solute-binding protein family 3"
FT                   /db_xref="EnsemblGenomes-Gn:Snov_0163"
FT                   /db_xref="EnsemblGenomes-Tr:ADH87499"
FT                   /db_xref="InterPro:IPR001638"
FT                   /db_xref="UniProtKB/TrEMBL:D7A0Y9"
FT                   /inference="protein motif:PFAM:PF00497"
FT                   /protein_id="ADH87499.1"
FT                   /translation="MAKGIGILAAAALTLAAAMPAQADKLDDIIASGTLRCAVVLDFPP
FT                   MGSRDASNNPIGFDVDYCNDLAKVLGVKAEIVETPFPDRIPALVSGRVDVGVASTSDTL
FT                   ERAKTAGFTIPYFAFKMVVLTKDGLGIKDYDSLKGKKTGSVSGTFEALALEKDVKAWGT
FT                   GSFRGYQTQADVFLALAQGQIEATVVTSTVAAAIVKEGKYKGLMMGGDAPYDIDYVALI
FT                   ALRNEQGLINYLNLFINQQVRTGRYKALYEKWVGLGEAPNLTVPGVYR"
     MAKGIGILAA AALTLAAAMP AQADKLDDII ASGTLRCAVV LDFPPMGSRD ASNNPIGFDV        60
     DYCNDLAKVL GVKAEIVETP FPDRIPALVS GRVDVGVAST SDTLERAKTA GFTIPYFAFK       120
     MVVLTKDGLG IKDYDSLKGK KTGSVSGTFE ALALEKDVKA WGTGSFRGYQ TQADVFLALA       180
     QGQIEATVVT STVAAAIVKE GKYKGLMMGG DAPYDIDYVA LIALRNEQGL INYLNLFINQ       240
     QVRTGRYKAL YEKWVGLGEA PNLTVPGVYR                                        270
//

If you have problems or comments...

PBIL Back to PBIL home page