(data stored in ACNUC1104 zone)

EMBL: CP002026.PE163

CP002026.PE163       Location/Qualifiers
FT   CDS             complement(160351..161160)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snov_0164"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Snov_0164"
FT                   /db_xref="EnsemblGenomes-Tr:ADH87500"
FT                   /db_xref="UniProtKB/TrEMBL:D7A0Z0"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADH87500.1"
FT                   /translation="MRLSPRRLLRPRALKEADQRDTGAENVLAGEPGGLVGVAGDAGFQ
FT                   YALVLAARARHAVGQHELGTQVAVDAVQRGADGLQVVGPRGRLVERIVEAAVELAPVRG
FT                   IRLRGECIGEALGVLEPLVRDALHRIAQDFRLQQGAEFEDLADLVGRERGDHGAAVALR
FT                   RHQALLLETRQRLAHRDAADVEQAGDVVLPKGLAFGNVALGDGLAQRVENDVRRGCHLR
FT                   DVRCLNLHLVSPPGFAADRLKSPIRCRQVLCAACGFGGRRARGATAQ"
     MRLSPRRLLR PRALKEADQR DTGAENVLAG EPGGLVGVAG DAGFQYALVL AARARHAVGQ        60
     HELGTQVAVD AVQRGADGLQ VVGPRGRLVE RIVEAAVELA PVRGIRLRGE CIGEALGVLE       120
     PLVRDALHRI AQDFRLQQGA EFEDLADLVG RERGDHGAAV ALRRHQALLL ETRQRLAHRD       180
     AADVEQAGDV VLPKGLAFGN VALGDGLAQR VENDVRRGCH LRDVRCLNLH LVSPPGFAAD       240
     RLKSPIRCRQ VLCAACGFGG RRARGATAQ                                         269
//

If you have problems or comments...

PBIL Back to PBIL home page