(data stored in ACNUC1104 zone)

EMBL: CP002026.PE164

CP002026.PE164       Location/Qualifiers
FT   CDS             complement(161157..162602)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snov_0165"
FT                   /product="integral membrane sensor signal transduction
FT                   histidine kinase"
FT                   /note="KEGG: ccs:CCNA_01239 two-component sensor histidine
FT                   kinase; PFAM: ATP-binding region ATPase domain protein;
FT                   histidine kinase HAMP region domain protein; SMART:
FT                   ATP-binding region ATPase domain protein; histidine kinase
FT                   HAMP region domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Snov_0165"
FT                   /db_xref="EnsemblGenomes-Tr:ADH87501"
FT                   /db_xref="GOA:D7A0Z1"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:D7A0Z1"
FT                   /inference="protein motif:PFAM:PF02518"
FT                   /protein_id="ADH87501.1"
FT                   /translation="MMGARFPVLRRAPLAARMSILLIIVVAAVQLINLALVVLVPPPSE
FT                   ETYSAAQFAAALKGEDAGTDFSLRRFQDSEMRPQHPALVPIRDQLATYFGVPPEQVRVE
FT                   VAGAAPDTPRQDKGLLDGSVILKFASLEASSFDGQKALFQGLFKVGLRQGDGSWLVARP
FT                   TGALHALWKQRALLWLLSTIVVAIPCAYLVAHKLAEPIRRFGAAAEELGRNPGAPPIDT
FT                   SGPKEIAAAASAFNDMQRRLNRYVDDRVMMMGAIAHDLRTPLMRLAFRLEEAPPTLAGK
FT                   AREDIDEMKAMLAAVLSYVRSVQSERPRERHDLRSLVLSIADELADLGHDVSVEDGDDV
FT                   VVTGDGLGLKSLFANVIGNAAKYGGSARVRLAAEDGHVTIIVDDDGPGLPSDELERVFE
FT                   PFYRHETSRNRATGGVGLGLATARSVAIAHGGSIRLDNRAHGGLRATVVLPLVPAAEPA
FT                   PAEACGCSISSLLPRPGREPHTA"
     MMGARFPVLR RAPLAARMSI LLIIVVAAVQ LINLALVVLV PPPSEETYSA AQFAAALKGE        60
     DAGTDFSLRR FQDSEMRPQH PALVPIRDQL ATYFGVPPEQ VRVEVAGAAP DTPRQDKGLL       120
     DGSVILKFAS LEASSFDGQK ALFQGLFKVG LRQGDGSWLV ARPTGALHAL WKQRALLWLL       180
     STIVVAIPCA YLVAHKLAEP IRRFGAAAEE LGRNPGAPPI DTSGPKEIAA AASAFNDMQR       240
     RLNRYVDDRV MMMGAIAHDL RTPLMRLAFR LEEAPPTLAG KAREDIDEMK AMLAAVLSYV       300
     RSVQSERPRE RHDLRSLVLS IADELADLGH DVSVEDGDDV VVTGDGLGLK SLFANVIGNA       360
     AKYGGSARVR LAAEDGHVTI IVDDDGPGLP SDELERVFEP FYRHETSRNR ATGGVGLGLA       420
     TARSVAIAHG GSIRLDNRAH GGLRATVVLP LVPAAEPAPA EACGCSISSL LPRPGREPHT       480
     A                                                                       481
//

If you have problems or comments...

PBIL Back to PBIL home page