(data stored in ACNUC1104 zone)

EMBL: CP002026.PE167

CP002026.PE167       Location/Qualifiers
FT   CDS             complement(164015..164575)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snov_0168"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: azc:AZC_2752 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Snov_0168"
FT                   /db_xref="EnsemblGenomes-Tr:ADH87504"
FT                   /db_xref="UniProtKB/TrEMBL:D7A0Z4"
FT                   /inference="similar to AA sequence:KEGG:AZC_2752"
FT                   /protein_id="ADH87504.1"
FT                   /translation="MRITPALIAAALFGVLAATAVPAAESGKPENHRAGEARKDDRPRE
FT                   PAETKLAICLAPRLPGPLELASRLDAYETFVGIRPAQIDAWRDYTDALQAMTVGAEAER
FT                   RELPATGLTDGDALSQSATLAGAVIATGERATRLLASVDALRAVLSEAQKARLDEAGPL
FT                   FPPKCAGTLAEAGTPADAAAAPH"
     MRITPALIAA ALFGVLAATA VPAAESGKPE NHRAGEARKD DRPREPAETK LAICLAPRLP        60
     GPLELASRLD AYETFVGIRP AQIDAWRDYT DALQAMTVGA EAERRELPAT GLTDGDALSQ       120
     SATLAGAVIA TGERATRLLA SVDALRAVLS EAQKARLDEA GPLFPPKCAG TLAEAGTPAD       180
     AAAAPH                                                                  186
//

If you have problems or comments...

PBIL Back to PBIL home page