(data stored in ACNUC1104 zone)

EMBL: CP002026.PE168

CP002026.PE168       Location/Qualifiers
FT   CDS             complement(164820..165488)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snov_0169"
FT                   /product="isoprenylcysteine carboxyl methyltransferase
FT                   protein"
FT                   /note="KEGG: ara:Arad_8431 isoprenylcysteine carboxyl
FT                   methyltransferase protein"
FT                   /db_xref="EnsemblGenomes-Gn:Snov_0169"
FT                   /db_xref="EnsemblGenomes-Tr:ADH87505"
FT                   /db_xref="GOA:D7A0Z5"
FT                   /db_xref="InterPro:IPR007318"
FT                   /db_xref="UniProtKB/TrEMBL:D7A0Z5"
FT                   /inference="similar to AA sequence:KEGG:Arad_8431"
FT                   /protein_id="ADH87505.1"
FT                   /translation="MVSYLLQCMAWTVFMAALVLLPAGTLDYPGGWAFIVLFAVGGLAM
FT                   VLWLGKYSPSLLRERMSAPWQREQKGWDKVWLTAFMLAFLAWLVFMAWDAGRTRFIAMP
FT                   AWLQVVGFLIALAYMAGVWWTFRENAFAAPVVKIQEGQKVIDTGPYAYVRHPMYTSALL
FT                   FFISLPLILGSWWGLLLAVPFVLGVAWRAVHEEEALRVGLPGYDAYAARVRYRFVPMVW
FT                   "
     MVSYLLQCMA WTVFMAALVL LPAGTLDYPG GWAFIVLFAV GGLAMVLWLG KYSPSLLRER        60
     MSAPWQREQK GWDKVWLTAF MLAFLAWLVF MAWDAGRTRF IAMPAWLQVV GFLIALAYMA       120
     GVWWTFRENA FAAPVVKIQE GQKVIDTGPY AYVRHPMYTS ALLFFISLPL ILGSWWGLLL       180
     AVPFVLGVAW RAVHEEEALR VGLPGYDAYA ARVRYRFVPM VW                          222
//

If you have problems or comments...

PBIL Back to PBIL home page