(data stored in ACNUC1104 zone)

EMBL: CP002026.PE171

CP002026.PE171       Location/Qualifiers
FT   CDS             complement(166481..167734)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snov_0172"
FT                   /product="amidase, hydantoinase/carbamoylase family"
FT                   /EC_number="3.5.1.87"
FT                   /note="TIGRFAM: amidase, hydantoinase/carbamoylase family;
FT                   KEGG: mrd:Mrad2831_5813 allantoate amidohydrolase; PFAM:
FT                   peptidase M20"
FT                   /db_xref="EnsemblGenomes-Gn:Snov_0172"
FT                   /db_xref="EnsemblGenomes-Tr:ADH87508"
FT                   /db_xref="GOA:D7A0Z8"
FT                   /db_xref="InterPro:IPR002933"
FT                   /db_xref="InterPro:IPR010158"
FT                   /db_xref="InterPro:IPR036264"
FT                   /db_xref="UniProtKB/TrEMBL:D7A0Z8"
FT                   /inference="protein motif:TFAM:TIGR01879"
FT                   /protein_id="ADH87508.1"
FT                   /translation="MSPLAKAIALTEQLFEELRAHTTDEPGITRAAYGEGEEFAHAVVR
FT                   RVGRELGLNEAVDAAGNLYLTLEGEDPTLPSWIIGSHIDSVPHGGNYDGAAGVFAGLAL
FT                   VHALRTEGRRLTRNLTIMVIRAEESTWFPVSYLGSRAAFGLLPADALETRRADTGLTLR
FT                   EHMAALGLNPDAVARGETYLDPASIHGFVEVHIEQGPVLEREDAPIGLVTGIAGSFRYR
FT                   KGRVLGQYGHSGAVPRAYRQDAVIGFADLVAALETTWDGLERDGERATITFGEVGTDPT
FT                   QHAFSKVPGEVGFCLDVRSESPMVLERIHAELFAHAAIIEQRRGVRFDFGEQSGSTPAV
FT                   LDAGQRAGLKAAAACEGIRAIEMPSGAGHDTATFAGRGVPASLIFVRNQNGSHNPFEAM
FT                   RIEDFACAVRTLLSFLKV"
     MSPLAKAIAL TEQLFEELRA HTTDEPGITR AAYGEGEEFA HAVVRRVGRE LGLNEAVDAA        60
     GNLYLTLEGE DPTLPSWIIG SHIDSVPHGG NYDGAAGVFA GLALVHALRT EGRRLTRNLT       120
     IMVIRAEEST WFPVSYLGSR AAFGLLPADA LETRRADTGL TLREHMAALG LNPDAVARGE       180
     TYLDPASIHG FVEVHIEQGP VLEREDAPIG LVTGIAGSFR YRKGRVLGQY GHSGAVPRAY       240
     RQDAVIGFAD LVAALETTWD GLERDGERAT ITFGEVGTDP TQHAFSKVPG EVGFCLDVRS       300
     ESPMVLERIH AELFAHAAII EQRRGVRFDF GEQSGSTPAV LDAGQRAGLK AAAACEGIRA       360
     IEMPSGAGHD TATFAGRGVP ASLIFVRNQN GSHNPFEAMR IEDFACAVRT LLSFLKV          417
//

If you have problems or comments...

PBIL Back to PBIL home page