(data stored in ACNUC1104 zone)

EMBL: CP002026.PE172

CP002026.PE172       Location/Qualifiers
FT   CDS             complement(167731..168720)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snov_0173"
FT                   /product="D-isomer specific 2-hydroxyacid dehydrogenase
FT                   NAD-binding protein"
FT                   /note="PFAM: D-isomer specific 2-hydroxyacid dehydrogenase
FT                   NAD-binding; D-isomer specific 2-hydroxyacid dehydrogenase
FT                   catalytic region; KEGG: mrd:Mrad2831_4405 D-isomer specific
FT                   2-hydroxyacid dehydrogenase NAD-binding"
FT                   /db_xref="EnsemblGenomes-Gn:Snov_0173"
FT                   /db_xref="EnsemblGenomes-Tr:ADH87509"
FT                   /db_xref="GOA:D7A0Z9"
FT                   /db_xref="InterPro:IPR006139"
FT                   /db_xref="InterPro:IPR006140"
FT                   /db_xref="InterPro:IPR029753"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:D7A0Z9"
FT                   /inference="protein motif:PFAM:PF02826"
FT                   /protein_id="ADH87509.1"
FT                   /translation="MSSLCLILQRIHDAGVEHLLAAGHEVRLATSLEPGALLAEIAPAR
FT                   AVLTRDARVDGPLMDAAPDLKVIGVHGAGVDNVDIAAATARGIPVVNTPGANARSVAEH
FT                   ALALAFHLAKALGPGERAARASDGSFKYRARMIELDGAVFGLVGFGAIGRETGRLARAL
FT                   GMEVIVWTRRPDDPAVAAAGFTHVADLNELLARADIVSLHLPGGAQTRHLIGAPELARM
FT                   KDTAYLINTARGTIIDEAALVEALREGRIAGAGLDVFETEPMPPSSPLIGFDNVVLSPH
FT                   VGGSTQAALRRTAVALAEQVNDVLAGRRPAHLVNPEVWPIAAIAEAGA"
     MSSLCLILQR IHDAGVEHLL AAGHEVRLAT SLEPGALLAE IAPARAVLTR DARVDGPLMD        60
     AAPDLKVIGV HGAGVDNVDI AAATARGIPV VNTPGANARS VAEHALALAF HLAKALGPGE       120
     RAARASDGSF KYRARMIELD GAVFGLVGFG AIGRETGRLA RALGMEVIVW TRRPDDPAVA       180
     AAGFTHVADL NELLARADIV SLHLPGGAQT RHLIGAPELA RMKDTAYLIN TARGTIIDEA       240
     ALVEALREGR IAGAGLDVFE TEPMPPSSPL IGFDNVVLSP HVGGSTQAAL RRTAVALAEQ       300
     VNDVLAGRRP AHLVNPEVWP IAAIAEAGA                                         329
//

If you have problems or comments...

PBIL Back to PBIL home page