(data stored in ACNUC1104 zone)

EMBL: CP002026.PE176

CP002026.PE176       Location/Qualifiers
FT   CDS             complement(171223..172023)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snov_0177"
FT                   /product="extracellular solute-binding protein family 3"
FT                   /note="KEGG: ara:Arad_7980 amino acid ABC transporter;
FT                   PFAM: extracellular solute-binding protein family 3; SMART:
FT                   extracellular solute-binding protein family 3"
FT                   /db_xref="EnsemblGenomes-Gn:Snov_0177"
FT                   /db_xref="EnsemblGenomes-Tr:ADH87513"
FT                   /db_xref="InterPro:IPR001638"
FT                   /db_xref="UniProtKB/TrEMBL:D7A103"
FT                   /inference="protein motif:PFAM:PF00497"
FT                   /protein_id="ADH87513.1"
FT                   /translation="MRLNLLPVLAAALVGGLVTGGLSAPANAQQLELVKPGALLVATEG
FT                   TYPPFSMRTPDGQLDGLEIRVAKEIARRLNLTYEPVVIKWEALLVGLAADQYDFASAAM
FT                   DITAERQKQVMFADGWLESGGRVVTQKGSPIKTPADIKGKTVGVLVSSTWQKLAEERGA
FT                   TVKAYKAESDAIQDLVNGQIDAVITDSIAAAYAIEASKLPLVMVDDYLSHIQKGFPFKK
FT                   GKPNLVKAVNKALADMIADGTYAKLTTPLIGYSPAPKDPIKTIF"
     MRLNLLPVLA AALVGGLVTG GLSAPANAQQ LELVKPGALL VATEGTYPPF SMRTPDGQLD        60
     GLEIRVAKEI ARRLNLTYEP VVIKWEALLV GLAADQYDFA SAAMDITAER QKQVMFADGW       120
     LESGGRVVTQ KGSPIKTPAD IKGKTVGVLV SSTWQKLAEE RGATVKAYKA ESDAIQDLVN       180
     GQIDAVITDS IAAAYAIEAS KLPLVMVDDY LSHIQKGFPF KKGKPNLVKA VNKALADMIA       240
     DGTYAKLTTP LIGYSPAPKD PIKTIF                                            266
//

If you have problems or comments...

PBIL Back to PBIL home page