(data stored in ACNUC1104 zone)

EMBL: CP002026.PE178

CP002026.PE178       Location/Qualifiers
FT   CDS             complement(173079..173747)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snov_0179"
FT                   /product="polar amino acid ABC transporter, inner membrane
FT                   subunit"
FT                   /note="KEGG: rsh:Rsph17029_3475 polar amino acid ABC
FT                   transporter, inner membrane subunit; TIGRFAM: polar amino
FT                   acid ABC transporter, inner membrane subunit; PFAM:
FT                   binding-protein-dependent transport systems inner membrane
FT                   component"
FT                   /db_xref="EnsemblGenomes-Gn:Snov_0179"
FT                   /db_xref="EnsemblGenomes-Tr:ADH87515"
FT                   /db_xref="GOA:D7A105"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR010065"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:D7A105"
FT                   /inference="protein motif:TFAM:TIGR01726"
FT                   /protein_id="ADH87515.1"
FT                   /translation="MIEKIAVWWEGFAPYVPGFLAASWLVLVLSLLAILVSWGCGLIAA
FT                   LGKVSRFAALRKASEFYIWFIRGTPTLIQIFIIYFGLPQLGLRLSPFVAGVVALGFNGG
FT                   AYVAEIVRAGLSAIPKGQTESAQALGMGRWQMMTRIILPQVFRVILPPVTNEAITMVKN
FT                   TSLLSTITVVELTLYSQTIIATTFRPFEFYIATALIYLVMTSLISQAAAHAERHYARSL
FT                   "
     MIEKIAVWWE GFAPYVPGFL AASWLVLVLS LLAILVSWGC GLIAALGKVS RFAALRKASE        60
     FYIWFIRGTP TLIQIFIIYF GLPQLGLRLS PFVAGVVALG FNGGAYVAEI VRAGLSAIPK       120
     GQTESAQALG MGRWQMMTRI ILPQVFRVIL PPVTNEAITM VKNTSLLSTI TVVELTLYSQ       180
     TIIATTFRPF EFYIATALIY LVMTSLISQA AAHAERHYAR SL                          222
//

If you have problems or comments...

PBIL Back to PBIL home page