(data stored in ACNUC1104 zone)

EMBL: CP002026.PE179

CP002026.PE179       Location/Qualifiers
FT   CDS             complement(173744..174553)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snov_0180"
FT                   /product="ABC transporter related protein"
FT                   /note="KEGG: mrd:Mrad2831_5811 ABC transporter related;
FT                   PFAM: ABC transporter related; SMART: AAA ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Snov_0180"
FT                   /db_xref="EnsemblGenomes-Tr:ADH87516"
FT                   /db_xref="GOA:D7A106"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR030679"
FT                   /db_xref="UniProtKB/TrEMBL:D7A106"
FT                   /inference="protein motif:PFAM:PF00005"
FT                   /protein_id="ADH87516.1"
FT                   /translation="MDGEPLIRIRDLRKSFGAHEVLKGVSLDVHAGEVVSIIGASGSGK
FT                   STFLRCINVLEKPTGGTMDFGGFHFDYEQGARLQPTAAQLRELRARIGMVFQSYNLWPH
FT                   MTVLENVIEAPIRVKGETPAEARDKAEALLARIGLAEKRHAYPSKLSGGQQQRVAIVRA
FT                   LAMQPKLMLFDEVTSALDPELVGEVLSLMASLAAEGMTMLLVTHEIGFAREVSNRVIFF
FT                   DQGVIAEDGHPREVLRQPRSERLQQFLRRVLHEDAYHAAPLTEGAAS"
     MDGEPLIRIR DLRKSFGAHE VLKGVSLDVH AGEVVSIIGA SGSGKSTFLR CINVLEKPTG        60
     GTMDFGGFHF DYEQGARLQP TAAQLRELRA RIGMVFQSYN LWPHMTVLEN VIEAPIRVKG       120
     ETPAEARDKA EALLARIGLA EKRHAYPSKL SGGQQQRVAI VRALAMQPKL MLFDEVTSAL       180
     DPELVGEVLS LMASLAAEGM TMLLVTHEIG FAREVSNRVI FFDQGVIAED GHPREVLRQP       240
     RSERLQQFLR RVLHEDAYHA APLTEGAAS                                         269
//

If you have problems or comments...

PBIL Back to PBIL home page