(data stored in ACNUC1104 zone)

EMBL: CP002026.PE183

CP002026.PE183       Location/Qualifiers
FT   CDS             177333..178103
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snov_0184"
FT                   /product="LamB/YcsF family protein"
FT                   /note="PFAM: LamB/YcsF family protein; KEGG:
FT                   mrd:Mrad2831_5814 LamB/YcsF family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Snov_0184"
FT                   /db_xref="EnsemblGenomes-Tr:ADH87520"
FT                   /db_xref="GOA:D7A110"
FT                   /db_xref="InterPro:IPR005501"
FT                   /db_xref="InterPro:IPR011330"
FT                   /db_xref="UniProtKB/TrEMBL:D7A110"
FT                   /inference="protein motif:PFAM:PF03746"
FT                   /protein_id="ADH87520.1"
FT                   /translation="MKTIDLNCDMGEGFGVYSLGDDKAMLDIVTSANIACGFHAGDPLV
FT                   MADTLASAKARGVGCGAHPSFMDLWGFGRRPILGQSVGEIEKQLIYQIGALQALAHAQG
FT                   FKLAHVKTHGSLGNMANEDIELARAVARAIKAVDPGFIFIVMPGLPTERAGEEMGLKVA
FT                   REIYADRAYADNGNLASRKLPGAVLHDAEAAAERVLRIVESGEVVSISGARIPVRADTV
FT                   CVHGDTADAVAMARAVRTRLEGAGYGVRPMAEWL"
     MKTIDLNCDM GEGFGVYSLG DDKAMLDIVT SANIACGFHA GDPLVMADTL ASAKARGVGC        60
     GAHPSFMDLW GFGRRPILGQ SVGEIEKQLI YQIGALQALA HAQGFKLAHV KTHGSLGNMA       120
     NEDIELARAV ARAIKAVDPG FIFIVMPGLP TERAGEEMGL KVAREIYADR AYADNGNLAS       180
     RKLPGAVLHD AEAAAERVLR IVESGEVVSI SGARIPVRAD TVCVHGDTAD AVAMARAVRT       240
     RLEGAGYGVR PMAEWL                                                       256
//

If you have problems or comments...

PBIL Back to PBIL home page