(data stored in ACNUC1104 zone)

EMBL: CP002026.PE185

CP002026.PE185       Location/Qualifiers
FT   CDS             179360..180115
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snov_0186"
FT                   /product="transcriptional regulator, GntR family"
FT                   /note="KEGG: bxe:Bxe_A4083 GntR family transcriptional
FT                   regulator; PFAM: regulatory protein GntR HTH; UbiC
FT                   transcription regulator-associated domain protein; SMART:
FT                   regulatory protein GntR HTH"
FT                   /db_xref="EnsemblGenomes-Gn:Snov_0186"
FT                   /db_xref="EnsemblGenomes-Tr:ADH87522"
FT                   /db_xref="GOA:D7A112"
FT                   /db_xref="InterPro:IPR000524"
FT                   /db_xref="InterPro:IPR011663"
FT                   /db_xref="InterPro:IPR028978"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:D7A112"
FT                   /inference="protein motif:PFAM:PF00392"
FT                   /protein_id="ADH87522.1"
FT                   /translation="MSDADPAVPEKPGRAARYSEIEAALRAEINAGTHPVGAHLPTEHE
FT                   LCARFAASRFTIRQALAGLREEGLIDARAGVGTIVLASRRRETFVHRLSSIEELLQYPS
FT                   ETRRQHIRTDALAASPELAMLLKCRVGQPWVRLKALRLTQASLAPIAYFDIYVLPEHAG
FT                   VFDLPNPEGVSVLRQLEEMLNVRAAHAQVEIFVGHVTAELAEPLMARQDDPALVIIRRY
FT                   RGQDGAVFLVTYSVHPENRFTLNIEFERR"
     MSDADPAVPE KPGRAARYSE IEAALRAEIN AGTHPVGAHL PTEHELCARF AASRFTIRQA        60
     LAGLREEGLI DARAGVGTIV LASRRRETFV HRLSSIEELL QYPSETRRQH IRTDALAASP       120
     ELAMLLKCRV GQPWVRLKAL RLTQASLAPI AYFDIYVLPE HAGVFDLPNP EGVSVLRQLE       180
     EMLNVRAAHA QVEIFVGHVT AELAEPLMAR QDDPALVIIR RYRGQDGAVF LVTYSVHPEN       240
     RFTLNIEFER R                                                            251
//

If you have problems or comments...

PBIL Back to PBIL home page