(data stored in ACNUC1104 zone)

EMBL: CP002026.PE188

CP002026.PE188       Location/Qualifiers
FT   CDS             182626..183072
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snov_0189"
FT                   /product="protein of unknown function DUF1468"
FT                   /note="PFAM: protein of unknown function DUF1468; KEGG:
FT                   mms:mma_0471 small permease component of tripartite
FT                   tricarboxylate transporter"
FT                   /db_xref="EnsemblGenomes-Gn:Snov_0189"
FT                   /db_xref="EnsemblGenomes-Tr:ADH87525"
FT                   /db_xref="GOA:D7A115"
FT                   /db_xref="InterPro:IPR009936"
FT                   /db_xref="UniProtKB/TrEMBL:D7A115"
FT                   /inference="protein motif:PFAM:PF07331"
FT                   /protein_id="ADH87525.1"
FT                   /translation="MDIRISSDFLTGLLFCGLGAVAIIIGSDYPIGTAARMGAGYFPLL
FT                   VSSGLILLGGVLIIRSFVTETEEVGSIDIRPLALLIGSILLFGLLIEDWGFPVAGLAVV
FT                   IGARIAGRQYKPLETILLAVGLVGFCLVLFSYGLGLHLPATHLW"
     MDIRISSDFL TGLLFCGLGA VAIIIGSDYP IGTAARMGAG YFPLLVSSGL ILLGGVLIIR        60
     SFVTETEEVG SIDIRPLALL IGSILLFGLL IEDWGFPVAG LAVVIGARIA GRQYKPLETI       120
     LLAVGLVGFC LVLFSYGLGL HLPATHLW                                          148
//

If you have problems or comments...

PBIL Back to PBIL home page