(data stored in ACNUC1104 zone)

EMBL: CP002026.PE19

CP002026.PE19        Location/Qualifiers
FT   CDS             14261..14455
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snov_0019"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Snov_0019"
FT                   /db_xref="EnsemblGenomes-Tr:ADH87356"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZZU2"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADH87356.1"
FT                   /translation="MPWVRFIADFDFKPKPAITIAYRAGFVGLVSRSCAAKAKARGLAI
FT                   PVSRPGSRRNDEVAADGKV"
     MPWVRFIADF DFKPKPAITI AYRAGFVGLV SRSCAAKAKA RGLAIPVSRP GSRRNDEVAA        60
     DGKV                                                                     64
//

If you have problems or comments...

PBIL Back to PBIL home page