(data stored in ACNUC1104 zone)

EMBL: CP002026.PE190

CP002026.PE190       Location/Qualifiers
FT   CDS             complement(184670..185629)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snov_0191"
FT                   /product="transcriptional regulator, LysR family"
FT                   /note="PFAM: LysR substrate-binding; regulatory protein
FT                   LysR; KEGG: dac:Daci_4360 LysR family transcriptional
FT                   regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Snov_0191"
FT                   /db_xref="EnsemblGenomes-Tr:ADH87527"
FT                   /db_xref="GOA:D7A117"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:D7A117"
FT                   /inference="protein motif:PFAM:PF03466"
FT                   /protein_id="ADH87527.1"
FT                   /translation="MELRSIEAFVRVAELGSITRASRDLGIVQPALSRHIQRIETEIGT
FT                   PLLVRLPRGVQLTLAGRRFLQHSRRILQEVARAAEEMNIGGDCLSGRVVVGISPTLSSL
FT                   LTPGLIERCASTYPAINLTIVEEFTRRLQTDLVNGQVDLALLTNPPPNRALRFTAVLTE
FT                   PIVVVMPRHSRGVSPVVTLDELASTPMLVTRGIRAMVDEQLAPHGVCIEVDCEIDAVEA
FT                   IRRMLLRGRGASIMPISAFRKEIDDGLLTGLAVGGVNLSRTIMLSHVGDKVSAAAHAVM
FT                   GLLRAEIDSLAQRGLFSALPDTSSHWAQPQQRGLAGAA"
     MELRSIEAFV RVAELGSITR ASRDLGIVQP ALSRHIQRIE TEIGTPLLVR LPRGVQLTLA        60
     GRRFLQHSRR ILQEVARAAE EMNIGGDCLS GRVVVGISPT LSSLLTPGLI ERCASTYPAI       120
     NLTIVEEFTR RLQTDLVNGQ VDLALLTNPP PNRALRFTAV LTEPIVVVMP RHSRGVSPVV       180
     TLDELASTPM LVTRGIRAMV DEQLAPHGVC IEVDCEIDAV EAIRRMLLRG RGASIMPISA       240
     FRKEIDDGLL TGLAVGGVNL SRTIMLSHVG DKVSAAAHAV MGLLRAEIDS LAQRGLFSAL       300
     PDTSSHWAQP QQRGLAGAA                                                    319
//

If you have problems or comments...

PBIL Back to PBIL home page