(data stored in ACNUC1104 zone)

EMBL: CP002026.PE195

CP002026.PE195       Location/Qualifiers
FT   CDS             189042..190016
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snov_0196"
FT                   /product="transcriptional regulator, LysR family"
FT                   /note="PFAM: regulatory protein LysR; LysR
FT                   substrate-binding; KEGG: jan:Jann_2940 LysR family
FT                   transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Snov_0196"
FT                   /db_xref="EnsemblGenomes-Tr:ADH87532"
FT                   /db_xref="GOA:D7A122"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:D7A122"
FT                   /inference="protein motif:PFAM:PF00126"
FT                   /protein_id="ADH87532.1"
FT                   /translation="MAMSTTLRDVRLFVAAYEERSFTAAAERENATQSGVSQHIRKIED
FT                   RFGVKLFARGGGSVQPTPAGESYYRHCIELLRLNEMANRSVGRFGAGLDGEMVVGLMPT
FT                   MTRSVLAPALARFVALHPNVGVRIWEAYSANLTQQVRAGELAFAIVPASTGTVGVKTTR
FT                   FAYTPEVLVSGAAAGREHMKALRLVDLGPLKVVVPSAQNARRASIETYLASNGVAVERR
FT                   LELDAMMGTLDFVASTDWVAILPGLMMAEEAARPVSPGTLRRFTVNPIADPPLGMDLVR
FT                   IEPARRPLSPAAAAFLDVLADETARVGGVWGERAGLYEEAGVS"
     MAMSTTLRDV RLFVAAYEER SFTAAAEREN ATQSGVSQHI RKIEDRFGVK LFARGGGSVQ        60
     PTPAGESYYR HCIELLRLNE MANRSVGRFG AGLDGEMVVG LMPTMTRSVL APALARFVAL       120
     HPNVGVRIWE AYSANLTQQV RAGELAFAIV PASTGTVGVK TTRFAYTPEV LVSGAAAGRE       180
     HMKALRLVDL GPLKVVVPSA QNARRASIET YLASNGVAVE RRLELDAMMG TLDFVASTDW       240
     VAILPGLMMA EEAARPVSPG TLRRFTVNPI ADPPLGMDLV RIEPARRPLS PAAAAFLDVL       300
     ADETARVGGV WGERAGLYEE AGVS                                              324
//

If you have problems or comments...

PBIL Back to PBIL home page