(data stored in ACNUC1104 zone)

EMBL: CP002026.PE197

CP002026.PE197       Location/Qualifiers
FT   CDS             complement(190469..191563)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snov_0198"
FT                   /product="Malate/L-lactate dehydrogenase"
FT                   /note="PFAM: Malate/L-lactate dehydrogenase; KEGG:
FT                   dsh:Dshi_2546 malate/L-lactate dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Snov_0198"
FT                   /db_xref="EnsemblGenomes-Tr:ADH87534"
FT                   /db_xref="GOA:D7A124"
FT                   /db_xref="InterPro:IPR003767"
FT                   /db_xref="InterPro:IPR036111"
FT                   /db_xref="UniProtKB/TrEMBL:D7A124"
FT                   /inference="protein motif:PFAM:PF02615"
FT                   /protein_id="ADH87534.1"
FT                   /translation="MNAAVKPEPGAAASLPSAALEGLIADAMRACDLPPEDARGVARLM
FT                   VEADLTGADGHGIFRLPQYVRRLKGGGVNPTPRIEVERAAPGVALVDGDNGMGHLVMSV
FT                   AVEHAVALAREIGVAWVGVRRSNHAGPAALYVDMLARRGMVGIYSVVASSNHMAIWGGT
FT                   SSLLGTNPLAIAIPAGEDAPPVLLDIATTVVSYGTVKKHVLNDIPLPEGWLVSKQDGSA
FT                   ITDPKRSGEGLLLPIGGHKGSGLALMLGLLAGTLNGAAFGSEVVDFNADSSTETNTGHF
FT                   LLALDVARFMRPEAFAALLAQQLNGLRADAPLPGTEGVRIPGDRRAALRETRARDGVPI
FT                   APPLRRQLDELATSLAIPPLDDRL"
     MNAAVKPEPG AAASLPSAAL EGLIADAMRA CDLPPEDARG VARLMVEADL TGADGHGIFR        60
     LPQYVRRLKG GGVNPTPRIE VERAAPGVAL VDGDNGMGHL VMSVAVEHAV ALAREIGVAW       120
     VGVRRSNHAG PAALYVDMLA RRGMVGIYSV VASSNHMAIW GGTSSLLGTN PLAIAIPAGE       180
     DAPPVLLDIA TTVVSYGTVK KHVLNDIPLP EGWLVSKQDG SAITDPKRSG EGLLLPIGGH       240
     KGSGLALMLG LLAGTLNGAA FGSEVVDFNA DSSTETNTGH FLLALDVARF MRPEAFAALL       300
     AQQLNGLRAD APLPGTEGVR IPGDRRAALR ETRARDGVPI APPLRRQLDE LATSLAIPPL       360
     DDRL                                                                    364
//

If you have problems or comments...

PBIL Back to PBIL home page