(data stored in ACNUC1104 zone)

EMBL: CP002026.PE199

CP002026.PE199       Location/Qualifiers
FT   CDS             complement(191967..192992)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snov_0200"
FT                   /product="amidohydrolase 2"
FT                   /note="PFAM: amidohydrolase 2; KEGG: swi:Swit_1683
FT                   amidohydrolase 2"
FT                   /db_xref="EnsemblGenomes-Gn:Snov_0200"
FT                   /db_xref="EnsemblGenomes-Tr:ADH87536"
FT                   /db_xref="GOA:D7A126"
FT                   /db_xref="InterPro:IPR006680"
FT                   /db_xref="InterPro:IPR032465"
FT                   /db_xref="InterPro:IPR032466"
FT                   /db_xref="UniProtKB/TrEMBL:D7A126"
FT                   /inference="protein motif:PFAM:PF04909"
FT                   /protein_id="ADH87536.1"
FT                   /translation="MNAPVIDVHAHILTEEMMARMRREAPEIGPTLSEVDAEGGVLKVG
FT                   DIVQRPFPRGGWDLDRRFADLDHAGFDLQVLSNCPQTFLYEREAALTAALCQIQNEAIA
FT                   DLVRRHPSRFLGIATLPMQDPARAANELRRAVTRLGLKGAQIGSHIEGRNLDDPALEPL
FT                   WATAEELGAFILIHPQKTAAGERTKEFYLKNLIGNPLETTIAAASLVFGGVLERYPDLR
FT                   ICLVHGGGFLPFQTGRMIHGWKERPECRRLIKESPEVSIRRLYFDTLTHFGPALRYLTD
FT                   TFGAGHVLLGSDYPFDMGTLEGARQVRAAGLAPAEEAAILGGTAAGWFGLSAAERKAVR
FT                   A"
     MNAPVIDVHA HILTEEMMAR MRREAPEIGP TLSEVDAEGG VLKVGDIVQR PFPRGGWDLD        60
     RRFADLDHAG FDLQVLSNCP QTFLYEREAA LTAALCQIQN EAIADLVRRH PSRFLGIATL       120
     PMQDPARAAN ELRRAVTRLG LKGAQIGSHI EGRNLDDPAL EPLWATAEEL GAFILIHPQK       180
     TAAGERTKEF YLKNLIGNPL ETTIAAASLV FGGVLERYPD LRICLVHGGG FLPFQTGRMI       240
     HGWKERPECR RLIKESPEVS IRRLYFDTLT HFGPALRYLT DTFGAGHVLL GSDYPFDMGT       300
     LEGARQVRAA GLAPAEEAAI LGGTAAGWFG LSAAERKAVR A                           341
//

If you have problems or comments...

PBIL Back to PBIL home page