(data stored in ACNUC1104 zone)

EMBL: CP002026.PE2

CP002026.PE2         Location/Qualifiers
FT   CDS             434..1672
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snov_0002"
FT                   /product="chromosomal replication initiator protein DnaA"
FT                   /note="TIGRFAM: chromosomal replication initiator protein
FT                   DnaA; PFAM: Chromosomal replication initiator DnaA;
FT                   Chromosomal replication initiator DnaA domain; KEGG:
FT                   azc:AZC_1014 chromosomal replication initiation protein;
FT                   SMART: Chromosomal replication initiator DnaA domain; AAA
FT                   ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Snov_0002"
FT                   /db_xref="EnsemblGenomes-Tr:ADH87339"
FT                   /db_xref="GOA:D6ZZS5"
FT                   /db_xref="InterPro:IPR001957"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR010921"
FT                   /db_xref="InterPro:IPR013159"
FT                   /db_xref="InterPro:IPR013317"
FT                   /db_xref="InterPro:IPR018312"
FT                   /db_xref="InterPro:IPR020591"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZZS5"
FT                   /inference="protein motif:TFAM:TIGR00362"
FT                   /protein_id="ADH87339.1"
FT                   /translation="MIDMGDALPPGVHTAADLMRHYEEVRRRMKAQTARRRGPPVPPPV
FT                   TAAVVPAVPVAPSVVEPPSFSPRDAALTFARYCVGECNRLAHAAACDVAASAPGLMPRF
FT                   NPLFVHGGTGLGKTHLLQALAQAAEESGRRVAYLTAERFMFGFVAAMKTGTTEDFRARF
FT                   GEIDLLLLDDVQGLHGKSVQQAFSSALNALMDAHRQVVIAADRHPGDLDAFDERLRSRL
FT                   GAGLVIELRSLDDEVRAAIIAAQAERAAVLSPGFALPVDVARFLASDGRMNARDLAGAV
FT                   NRLLAPHQFGGVEITMDMAQAVLRDVIRTGEPRRVRVDDILRVVTKQFGVTLADILSQR
FT                   RTANVVRPRQIAMYLAKTLTLRSLPEIGRRFGGRDHTTVLHAVRKMDGLRSHDAKLRAE
FT                   LDDLEAKIMERVA"
     MIDMGDALPP GVHTAADLMR HYEEVRRRMK AQTARRRGPP VPPPVTAAVV PAVPVAPSVV        60
     EPPSFSPRDA ALTFARYCVG ECNRLAHAAA CDVAASAPGL MPRFNPLFVH GGTGLGKTHL       120
     LQALAQAAEE SGRRVAYLTA ERFMFGFVAA MKTGTTEDFR ARFGEIDLLL LDDVQGLHGK       180
     SVQQAFSSAL NALMDAHRQV VIAADRHPGD LDAFDERLRS RLGAGLVIEL RSLDDEVRAA       240
     IIAAQAERAA VLSPGFALPV DVARFLASDG RMNARDLAGA VNRLLAPHQF GGVEITMDMA       300
     QAVLRDVIRT GEPRRVRVDD ILRVVTKQFG VTLADILSQR RTANVVRPRQ IAMYLAKTLT       360
     LRSLPEIGRR FGGRDHTTVL HAVRKMDGLR SHDAKLRAEL DDLEAKIMER VA               412
//

If you have problems or comments...

PBIL Back to PBIL home page