(data stored in ACNUC1104 zone)

EMBL: CP002026.PE20

CP002026.PE20        Location/Qualifiers
FT   CDS             14442..14912
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snov_0020"
FT                   /product="phage protein, HK97 gp10 family"
FT                   /note="KEGG: avi:Avi_1977 hypothetical protein; TIGRFAM:
FT                   phage protein, HK97 gp10 family; PFAM: TP901-1 ORF40 family
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Snov_0020"
FT                   /db_xref="EnsemblGenomes-Tr:ADH87357"
FT                   /db_xref="InterPro:IPR010064"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZZU3"
FT                   /inference="protein motif:TFAM:TIGR01725"
FT                   /protein_id="ADH87357.1"
FT                   /translation="MARSSIVGLAKLHRKIAKLPEQARTDIRAAMEKVAEQIVDLARSL
FT                   VPTVSGDLRDSIGWTWGRPPRGSISLGTVARAKLGASMTITIYAGNDEAFYARWVEFGT
FT                   AAHVNGGLFAGTRNPGTQARPFFYPAFRAHRRIARREVRKAIRSAARKVAKQ"
     MARSSIVGLA KLHRKIAKLP EQARTDIRAA MEKVAEQIVD LARSLVPTVS GDLRDSIGWT        60
     WGRPPRGSIS LGTVARAKLG ASMTITIYAG NDEAFYARWV EFGTAAHVNG GLFAGTRNPG       120
     TQARPFFYPA FRAHRRIARR EVRKAIRSAA RKVAKQ                                 156
//

If you have problems or comments...

PBIL Back to PBIL home page