(data stored in ACNUC1104 zone)

EMBL: CP002026.PE203

CP002026.PE203       Location/Qualifiers
FT   CDS             196199..196372
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snov_0204"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Snov_0204"
FT                   /db_xref="EnsemblGenomes-Tr:ADH87540"
FT                   /db_xref="UniProtKB/TrEMBL:D7A130"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADH87540.1"
FT                   /translation="MKGIIETYIYRNGIPIIHIGMDKVFVSLYTEKYAARGAPARHVSH
FT                   WEVHVIGVYVLK"
     MKGIIETYIY RNGIPIIHIG MDKVFVSLYT EKYAARGAPA RHVSHWEVHV IGVYVLK           57
//

If you have problems or comments...

PBIL Back to PBIL home page