(data stored in ACNUC1104 zone)

EMBL: CP002026.PE205

CP002026.PE205       Location/Qualifiers
FT   CDS             complement(196629..197636)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snov_0206"
FT                   /product="cobalamin synthesis protein P47K"
FT                   /note="PFAM: cobalamin synthesis protein P47K; cobalamin
FT                   synthesis CobW domain protein; KEGG: rce:RC1_0589 cobalamin
FT                   synthesis protein CobW, putative"
FT                   /db_xref="EnsemblGenomes-Gn:Snov_0206"
FT                   /db_xref="EnsemblGenomes-Tr:ADH87542"
FT                   /db_xref="InterPro:IPR003495"
FT                   /db_xref="InterPro:IPR011629"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036627"
FT                   /db_xref="UniProtKB/TrEMBL:D7A132"
FT                   /inference="protein motif:PFAM:PF02492"
FT                   /protein_id="ADH87542.1"
FT                   /translation="MAIPVVLITGFLGSGKTTLLNHLLWDPEMGDTAVIINEFGDVAID
FT                   HLLVESAIENAVVLQSGCICCTVRGDLVDTLDDLCAKVARGELPPFSRIAIETTGLADP
FT                   ASLVRTFLTERLLADRFTLRAVVTTVDAVNGAVQLDEFEEARHQAALADVIVLTKSDLA
FT                   SPEAVASLTARLKEANPSAAIVPVVHGAIAPDTLFALVPAHPSRADDEVLAWLNSEAFE
FT                   ETDGHAHSHHDSSIKPFAVTLDRPVTREALRSWLRSILSLRGADLLRMKGIVALKGEAA
FT                   PIVVHAVQNALYPPVQLAAWPSDDHTTRIVFITRDIAPEALRNSLEVLASRSAA"
     MAIPVVLITG FLGSGKTTLL NHLLWDPEMG DTAVIINEFG DVAIDHLLVE SAIENAVVLQ        60
     SGCICCTVRG DLVDTLDDLC AKVARGELPP FSRIAIETTG LADPASLVRT FLTERLLADR       120
     FTLRAVVTTV DAVNGAVQLD EFEEARHQAA LADVIVLTKS DLASPEAVAS LTARLKEANP       180
     SAAIVPVVHG AIAPDTLFAL VPAHPSRADD EVLAWLNSEA FEETDGHAHS HHDSSIKPFA       240
     VTLDRPVTRE ALRSWLRSIL SLRGADLLRM KGIVALKGEA APIVVHAVQN ALYPPVQLAA       300
     WPSDDHTTRI VFITRDIAPE ALRNSLEVLA SRSAA                                  335
//

If you have problems or comments...

PBIL Back to PBIL home page