(data stored in ACNUC1104 zone)

EMBL: CP002026.PE206

CP002026.PE206       Location/Qualifiers
FT   CDS             complement(197658..198896)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snov_0207"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: avi:Avi_5158 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Snov_0207"
FT                   /db_xref="EnsemblGenomes-Tr:ADH87543"
FT                   /db_xref="InterPro:IPR013211"
FT                   /db_xref="UniProtKB/TrEMBL:D7A133"
FT                   /inference="similar to AA sequence:KEGG:Avi_5158"
FT                   /protein_id="ADH87543.1"
FT                   /translation="MLDHTKAADVKIDLISGMKLIAHDPLAGFGGVGEGMSLQKAPDGR
FT                   RILWLAHEGPPKNFTGVDVTDPSRPKVIVQTDLPHNKVRSNSLETTGDVMAVAYQTYQP
FT                   GLQPAGIELFDISVPENPRSISFFDCSGPHSRGVHQVWFVDGEFIHCAAGAADFTPRNP
FT                   LDDQAYRIVDVRNPSKPVEAGRWWMPGTAEGDDAPPPERLKIDSGFRCHNTNVYPARPD
FT                   RAYVGYIDGGFYVMDISDKSRPTVISRFNPNPPFPGFAHTLLPLFGRDLAVATHECIHD
FT                   DGFDWPKLTWLLDIRREDNPVPLSTLPMPSFEEYSRKGGRFGCHNVHENPPRDTALQSE
FT                   ALIFSTLFNGGLRVHDISDPLAPREVAAFVPSAPPGARVPAIQINEVYVDENGIVYCAD
FT                   RHAGGLYILELDI"
     MLDHTKAADV KIDLISGMKL IAHDPLAGFG GVGEGMSLQK APDGRRILWL AHEGPPKNFT        60
     GVDVTDPSRP KVIVQTDLPH NKVRSNSLET TGDVMAVAYQ TYQPGLQPAG IELFDISVPE       120
     NPRSISFFDC SGPHSRGVHQ VWFVDGEFIH CAAGAADFTP RNPLDDQAYR IVDVRNPSKP       180
     VEAGRWWMPG TAEGDDAPPP ERLKIDSGFR CHNTNVYPAR PDRAYVGYID GGFYVMDISD       240
     KSRPTVISRF NPNPPFPGFA HTLLPLFGRD LAVATHECIH DDGFDWPKLT WLLDIRREDN       300
     PVPLSTLPMP SFEEYSRKGG RFGCHNVHEN PPRDTALQSE ALIFSTLFNG GLRVHDISDP       360
     LAPREVAAFV PSAPPGARVP AIQINEVYVD ENGIVYCADR HAGGLYILEL DI               412
//

If you have problems or comments...

PBIL Back to PBIL home page