(data stored in ACNUC1104 zone)

EMBL: CP002026.PE207

CP002026.PE207       Location/Qualifiers
FT   CDS             complement(199037..199780)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snov_0208"
FT                   /product="transcriptional regulator, GntR family"
FT                   /note="KEGG: azo:azo2437 transcriptional regulator; PFAM:
FT                   GntR domain protein; regulatory protein GntR HTH; SMART:
FT                   regulatory protein GntR HTH"
FT                   /db_xref="EnsemblGenomes-Gn:Snov_0208"
FT                   /db_xref="EnsemblGenomes-Tr:ADH87544"
FT                   /db_xref="GOA:D7A134"
FT                   /db_xref="InterPro:IPR000524"
FT                   /db_xref="InterPro:IPR008920"
FT                   /db_xref="InterPro:IPR011711"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:D7A134"
FT                   /inference="protein motif:PFAM:PF07729"
FT                   /protein_id="ADH87544.1"
FT                   /translation="MSLQPVVTNDDDATTLGIEIYARLRRDLIAGHHKPGERLRFRQLS
FT                   AAYSVGIAPLREALSRLVSDQLVRFEGHRGYTVAPLSLSDLNDLCALRTELSCNALRRS
FT                   IAQGDEDWEAEILAALHRLERAPLPHSVEDRKTVDEWEQRHDRFHYSLIAACGSPWLLH
FT                   FCGALSDHFQRYRRAVIVVTSSSEALLKRVREQHRTVAEAAIARDAERATTVLAEHFRG
FT                   SVEVVIRNYEEVSRSLSAGNGDDGR"
     MSLQPVVTND DDATTLGIEI YARLRRDLIA GHHKPGERLR FRQLSAAYSV GIAPLREALS        60
     RLVSDQLVRF EGHRGYTVAP LSLSDLNDLC ALRTELSCNA LRRSIAQGDE DWEAEILAAL       120
     HRLERAPLPH SVEDRKTVDE WEQRHDRFHY SLIAACGSPW LLHFCGALSD HFQRYRRAVI       180
     VVTSSSEALL KRVREQHRTV AEAAIARDAE RATTVLAEHF RGSVEVVIRN YEEVSRSLSA       240
     GNGDDGR                                                                 247
//

If you have problems or comments...

PBIL Back to PBIL home page