(data stored in ACNUC1104 zone)

EMBL: CP002026.PE208

CP002026.PE208       Location/Qualifiers
FT   CDS             complement(199880..200572)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snov_0209"
FT                   /product="transcriptional regulator, TetR family"
FT                   /note="PFAM: regulatory protein TetR; KEGG: jan:Jann_2950
FT                   TetR family transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Snov_0209"
FT                   /db_xref="EnsemblGenomes-Tr:ADH87545"
FT                   /db_xref="GOA:D7A135"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="UniProtKB/TrEMBL:D7A135"
FT                   /inference="protein motif:PFAM:PF00440"
FT                   /protein_id="ADH87545.1"
FT                   /translation="MAGRSSTSLAAGAKPPAPRRTRNKPEERHREFVRKAVELFAEVGF
FT                   EAGTRELAQRLGVTQPLLYRYFPSKDDLIAAVYQEIYVNRWKPEWREGLIDESRPIRDR
FT                   LIAFYEDYTETIFTPEWLRIYLFAGLRGVDINRRYAATVEAEILRPITVATRKSFGLGD
FT                   DDPPTPEEVELSWTLQGGIFYYGVREIVYRFPRTVDRATMIRNAVDTFLAGVGSVMKRL
FT                   AERESDPA"
     MAGRSSTSLA AGAKPPAPRR TRNKPEERHR EFVRKAVELF AEVGFEAGTR ELAQRLGVTQ        60
     PLLYRYFPSK DDLIAAVYQE IYVNRWKPEW REGLIDESRP IRDRLIAFYE DYTETIFTPE       120
     WLRIYLFAGL RGVDINRRYA ATVEAEILRP ITVATRKSFG LGDDDPPTPE EVELSWTLQG       180
     GIFYYGVREI VYRFPRTVDR ATMIRNAVDT FLAGVGSVMK RLAERESDPA                  230
//

If you have problems or comments...

PBIL Back to PBIL home page