(data stored in ACNUC1104 zone)

EMBL: CP002026.PE210

CP002026.PE210       Location/Qualifiers
FT   CDS             complement(201840..202319)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snov_0211"
FT                   /product="Glyoxalase/bleomycin resistance
FT                   protein/dioxygenase"
FT                   /note="PFAM: Glyoxalase/bleomycin resistance
FT                   protein/dioxygenase; KEGG: glyoxalase/bleomycin resistance
FT                   protein/dioxygenase"
FT                   /db_xref="EnsemblGenomes-Gn:Snov_0211"
FT                   /db_xref="EnsemblGenomes-Tr:ADH87547"
FT                   /db_xref="GOA:D7A137"
FT                   /db_xref="InterPro:IPR004360"
FT                   /db_xref="InterPro:IPR029068"
FT                   /db_xref="InterPro:IPR037523"
FT                   /db_xref="UniProtKB/TrEMBL:D7A137"
FT                   /inference="protein motif:PFAM:PF00903"
FT                   /protein_id="ADH87547.1"
FT                   /translation="MRATGLNHLSIGAKDVDASVRFYVEMFGMEVIPTYNFGFRTQYLR
FT                   CGDQQLHIFGLPDATPHYQHFAINVDDFMGVYERARDAGLIDHATFGNGVNEMPDGTVQ
FT                   LYLRDPGGNLVEVDWPDVSSLDTGRIPELKRLADRFEQVGENLEATLFLDRRRRA"
     MRATGLNHLS IGAKDVDASV RFYVEMFGME VIPTYNFGFR TQYLRCGDQQ LHIFGLPDAT        60
     PHYQHFAINV DDFMGVYERA RDAGLIDHAT FGNGVNEMPD GTVQLYLRDP GGNLVEVDWP       120
     DVSSLDTGRI PELKRLADRF EQVGENLEAT LFLDRRRRA                              159
//

If you have problems or comments...

PBIL Back to PBIL home page