(data stored in ACNUC1104 zone)

EMBL: CP002026.PE212

CP002026.PE212       Location/Qualifiers
FT   CDS             204067..204711
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snov_0213"
FT                   /product="transcriptional regulator, GntR family"
FT                   /note="KEGG: met:M446_0530 GntR family transcriptional
FT                   regulator; PFAM: GntR domain protein; regulatory protein
FT                   GntR HTH; SMART: regulatory protein GntR HTH"
FT                   /db_xref="EnsemblGenomes-Gn:Snov_0213"
FT                   /db_xref="EnsemblGenomes-Tr:ADH87549"
FT                   /db_xref="GOA:D7A139"
FT                   /db_xref="InterPro:IPR000524"
FT                   /db_xref="InterPro:IPR008920"
FT                   /db_xref="InterPro:IPR011711"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:D7A139"
FT                   /inference="protein motif:PFAM:PF07729"
FT                   /protein_id="ADH87549.1"
FT                   /translation="MKLVRNRVYEMVRREILSCAIVPGAELREADLAERFGVSKSPIRD
FT                   AMQKLELEGLVEIEPRRGHRVMPVSISDAADMLELRLILETAGVRKVALVATDAELAGL
FT                   DNFRDADTSSIPVFTEYNRRFHHHLAALARNRRLAEEMSRVMDLYERLCMVSLSAVTAH
FT                   GRNEGPLREHNDIIDALQARNGNAAARMLKRHIGRSQSQILRALESRPIVA"
     MKLVRNRVYE MVRREILSCA IVPGAELREA DLAERFGVSK SPIRDAMQKL ELEGLVEIEP        60
     RRGHRVMPVS ISDAADMLEL RLILETAGVR KVALVATDAE LAGLDNFRDA DTSSIPVFTE       120
     YNRRFHHHLA ALARNRRLAE EMSRVMDLYE RLCMVSLSAV TAHGRNEGPL REHNDIIDAL       180
     QARNGNAAAR MLKRHIGRSQ SQILRALESR PIVA                                   214
//

If you have problems or comments...

PBIL Back to PBIL home page