(data stored in ACNUC1104 zone)

EMBL: CP002026.PE217

CP002026.PE217       Location/Qualifiers
FT   CDS             208906..209820
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snov_0218"
FT                   /product="polysaccharide deacetylase"
FT                   /note="PFAM: polysaccharide deacetylase; KEGG:
FT                   jan:Jann_2944 polysaccharide deacetylase"
FT                   /db_xref="EnsemblGenomes-Gn:Snov_0218"
FT                   /db_xref="EnsemblGenomes-Tr:ADH87554"
FT                   /db_xref="GOA:D7A144"
FT                   /db_xref="InterPro:IPR002509"
FT                   /db_xref="InterPro:IPR011330"
FT                   /db_xref="UniProtKB/TrEMBL:D7A144"
FT                   /inference="protein motif:PFAM:PF01522"
FT                   /protein_id="ADH87554.1"
FT                   /translation="MGLLSERAPYLAFPDRPRLHLPGEARVAVWVIVNVEEWSIARAMP
FT                   RTVLPPPMGQPLMPDLPNWAWHEYGMRVGFWRLLKAIEQRGLRATFAVNGHVCRSYERV
FT                   ARAARDAGWEFMGHGYVQQPMHNTEDQRAAIFDTVAAIRDFTGRPPPGWESPGLTENNE
FT                   TLDLLKEAGIGYVANWVIDDLPLELDTPHGPILSVPYSVETNDIVVHAVQHQPSDAFNR
FT                   RCVDQFDRLWEEGGDNAKVMAISTHPYLTGVPHRIGYFEQLLDYVCSRDQVALMTGEEI
FT                   AGWYRGEQARLGSERREARAARG"
     MGLLSERAPY LAFPDRPRLH LPGEARVAVW VIVNVEEWSI ARAMPRTVLP PPMGQPLMPD        60
     LPNWAWHEYG MRVGFWRLLK AIEQRGLRAT FAVNGHVCRS YERVARAARD AGWEFMGHGY       120
     VQQPMHNTED QRAAIFDTVA AIRDFTGRPP PGWESPGLTE NNETLDLLKE AGIGYVANWV       180
     IDDLPLELDT PHGPILSVPY SVETNDIVVH AVQHQPSDAF NRRCVDQFDR LWEEGGDNAK       240
     VMAISTHPYL TGVPHRIGYF EQLLDYVCSR DQVALMTGEE IAGWYRGEQA RLGSERREAR       300
     AARG                                                                    304
//

If you have problems or comments...

PBIL Back to PBIL home page