(data stored in ACNUC1104 zone)

EMBL: CP002026.PE218

CP002026.PE218       Location/Qualifiers
FT   CDS             complement(209785..210456)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snov_0219"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: aav:Aave_0904 methyl-accepting chemotaxis
FT                   sensory transducer"
FT                   /db_xref="EnsemblGenomes-Gn:Snov_0219"
FT                   /db_xref="EnsemblGenomes-Tr:ADH87555"
FT                   /db_xref="UniProtKB/TrEMBL:D7A145"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADH87555.1"
FT                   /translation="MIALAGPAPWPVPYGIDKMPTGPTSLDRFPRVLLHPGKVLRLNDE
FT                   AFELPPPAIGQETVATDIRLADHLKRLSGTWNRPATLFIDGYFEHLRQVIAAHRTAIVE
FT                   HLAPVAGLFAPEDVLYSAPLPLPRALPPLPDGESVMVDMLFWLGGRAEAVLFAPSPLLP
FT                   AAERRRREGLAAVGIGVTVLTAGELVEPDTFAALLGEQGRAFWQDERLPSAPGGPRLPP
FT                   F"
     MIALAGPAPW PVPYGIDKMP TGPTSLDRFP RVLLHPGKVL RLNDEAFELP PPAIGQETVA        60
     TDIRLADHLK RLSGTWNRPA TLFIDGYFEH LRQVIAAHRT AIVEHLAPVA GLFAPEDVLY       120
     SAPLPLPRAL PPLPDGESVM VDMLFWLGGR AEAVLFAPSP LLPAAERRRR EGLAAVGIGV       180
     TVLTAGELVE PDTFAALLGE QGRAFWQDER LPSAPGGPRL PPF                         223
//

If you have problems or comments...

PBIL Back to PBIL home page