(data stored in ACNUC1104 zone)

EMBL: CP002026.PE22

CP002026.PE22        Location/Qualifiers
FT   CDS             15389..15835
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snov_0022"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: avi:Avi_1979 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Snov_0022"
FT                   /db_xref="EnsemblGenomes-Tr:ADH87359"
FT                   /db_xref="InterPro:IPR011855"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZZU5"
FT                   /inference="similar to AA sequence:KEGG:Avi_1979"
FT                   /protein_id="ADH87359.1"
FT                   /translation="MAKPTTMKGGQVRVLIGNDEDPIVYAAPCGFTERSVTLSKNLEEV
FT                   VIPDCDDPDAVDWVGRDASSLSMAISGEGVMAEQSVETWLDAWENPNSVPVKVEWGFPN
FT                   KTITWTGLMHVESIEATGANGQRVRKSISMQSDGEMARVVTPNA"
     MAKPTTMKGG QVRVLIGNDE DPIVYAAPCG FTERSVTLSK NLEEVVIPDC DDPDAVDWVG        60
     RDASSLSMAI SGEGVMAEQS VETWLDAWEN PNSVPVKVEW GFPNKTITWT GLMHVESIEA       120
     TGANGQRVRK SISMQSDGEM ARVVTPNA                                          148
//

If you have problems or comments...

PBIL Back to PBIL home page