(data stored in ACNUC1104 zone)

EMBL: CP002026.PE220

CP002026.PE220       Location/Qualifiers
FT   CDS             complement(211304..212101)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snov_0221"
FT                   /product="binding-protein-dependent transport systems inner
FT                   membrane component"
FT                   /note="PFAM: binding-protein-dependent transport systems
FT                   inner membrane component; KEGG: bja:bll6090 ABC transporter
FT                   permease protein"
FT                   /db_xref="EnsemblGenomes-Gn:Snov_0221"
FT                   /db_xref="EnsemblGenomes-Tr:ADH87557"
FT                   /db_xref="GOA:D7A147"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:D7A147"
FT                   /inference="protein motif:PFAM:PF00528"
FT                   /protein_id="ADH87557.1"
FT                   /translation="MSDILAGRRRPAGLAYAAVDLAVRFSPVLVLAVFWEFLGLSGIVS
FT                   QQMLPGLMEIFAAFVDMLVNGDLLYNTARSVSRAAAGLGAAVVVGVVVGLMMAQFRAAR
FT                   LLVNPIVQIFYPMPKSALIPVVMIWLGLGDSSKILLIFLGCLLPVVVGTYNGARGVNPF
FT                   LLWSASSLGASRLDVLHEVVLPAAMPDILNGCRTALAFSFILMVSSEFVIATDGVGFMI
FT                   SSLGDGGQYPAMFAAIFFVAGIGFAADRIYAMLARHMLRWREA"
     MSDILAGRRR PAGLAYAAVD LAVRFSPVLV LAVFWEFLGL SGIVSQQMLP GLMEIFAAFV        60
     DMLVNGDLLY NTARSVSRAA AGLGAAVVVG VVVGLMMAQF RAARLLVNPI VQIFYPMPKS       120
     ALIPVVMIWL GLGDSSKILL IFLGCLLPVV VGTYNGARGV NPFLLWSASS LGASRLDVLH       180
     EVVLPAAMPD ILNGCRTALA FSFILMVSSE FVIATDGVGF MISSLGDGGQ YPAMFAAIFF       240
     VAGIGFAADR IYAMLARHML RWREA                                             265
//

If you have problems or comments...

PBIL Back to PBIL home page